Recombinant Pig GPX5 Protein (22-219 aa), His-Myc-tagged

• Cat.No.: GPX5-2156P
• Product Overview: Recombinant Pig GPX5 Protein (22-219 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein.

Specification

• Species: Pig
• Source: E.coli
• Tag: His&Myc
• Protein Length: 22-219 aa
• Description: May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids. Since the purified porcine enzyme has very little activity towards hydrogen peroxide or organic hydroperoxides the protective effect is not likely to be exerted by its enzymatic activity. Instead, may protect sperm from premature acrosome reaction in the epididymis by binding to lipid peroxides, which might otherwise interact with phospholipase A2 and induce the acrosome reaction.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 27.6 kDa
• AA Sequence: NSNLEKMDCYKDVTGTIYDYDAFTLNGNEHIQFKQYAGKHVLFVNVATYCGLTAQYPELNTLQEELKPFGLVVLGFPCNQFGKQEPGENSEILLGLKYVRPGGGYVPNFQLFEKGDVNGEKEQKVFTFLKHSCPHPSELIGSIGYISWEPIRVHDIRWNFEKFLVGPDGVPVMRWVHETPISTVKSDILAYLKQFKTE
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: GPX5 glutathione peroxidase 5 (epididymal androgen-related protein) [ Sus scrofa ]
• Official Symbol: GPX5
• Synonyms: GPX5; EGLP; GPx-5; GSHPx-5
• Gene ID: 396920
• mRNA Refseq: NM_213886
• Protein Refseq: NP_999051
• UniProt ID: O18994