Recombinant Human GRAP2 protein, GST-tagged
| Cat.No. : | GRAP2-301176H |
| Product Overview : | Recombinant Human GRAP2 (1-330 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-Arg330 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMTR |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | GRAP2 GRB2-related adaptor protein 2 [ Homo sapiens ] |
| Official Symbol | GRAP2 |
| Synonyms | GRAP2; GRB2-related adaptor protein 2; GRB2-related adapter protein 2; GADS; GRBLG; GrbX; Grf40; Mona; grf-40; GRB-2-like protein; adapter protein GRID; grf40 adapter protein; SH3-SH2-SH3 adapter Mona; SH3-SH2-SH3 adaptor molecule; growth factor receptor-binding protein; GRB2-related protein with insert domain; hematopoietic cell-associated adapter protein GrpL; hematopoietic cell-associated adaptor protein GRPL; growth factor receptor-bound protein 2-related adaptor protein 2; P38; GRID; GRPL; GRB2L; GRAP-2; |
| Gene ID | 9402 |
| mRNA Refseq | NM_004810 |
| Protein Refseq | NP_004801 |
| MIM | 604518 |
| UniProt ID | O75791 |
| ◆ Recombinant Proteins | ||
| Grap2-1603R | Recombinant Rat Grap2 protein, His & T7-tagged | +Inquiry |
| GRAP2-1790R | Recombinant Rhesus Macaque GRAP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GRAP2-3432H | Recombinant Human GRB2 related adaptor protein 2 Protein, His-tagged | +Inquiry |
| GRAP2-27308TH | Recombinant Human GRAP2, His-tagged | +Inquiry |
| GRAP2-5033H | Recombinant Human GRAP2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GRAP2-5757HCL | Recombinant Human GRAP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRAP2 Products
Required fields are marked with *
My Review for All GRAP2 Products
Required fields are marked with *
