Recombinant Human GRAP2, His-tagged
Cat.No. : | GRAP2-27308TH |
Product Overview : | Recombinant full length Human GRAP2 with an N terminal His tag; 350 amino acids with tag, MWt 40.0 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 330 amino acids |
Description : | This gene encodes a member of the GRB2/Sem5/Drk family. This member is an adaptor-like protein involved in leukocyte-specific protein-tyrosine kinase signaling. Like its related family member, GRB2-related adaptor protein (GRAP), this protein contains an SH2 domain flanked by two SH3 domains. This protein interacts with other proteins, such as GRB2-associated binding protein 1 (GAB1) and the SLP-76 leukocyte protein (LCP2), through its SH3 domains. Transcript variants utilizing alternative polyA sites exist. |
Conjugation : | HIS |
Molecular Weight : | 40.000kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, 1mM EDTA, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMTR |
Sequence Similarities : | Belongs to the GRB2/sem-5/DRK family.Contains 1 SH2 domain.Contains 2 SH3 domains. |
Gene Name | GRAP2 GRB2-related adaptor protein 2 [ Homo sapiens ] |
Official Symbol | GRAP2 |
Synonyms | GRAP2; GRB2-related adaptor protein 2; GRB2-related adapter protein 2; GADS; GRBLG; GrbX; Grf40; Mona; |
Gene ID | 9402 |
mRNA Refseq | NM_004810 |
Protein Refseq | NP_004801 |
MIM | 604518 |
Uniprot ID | O75791 |
Chromosome Location | 22q13.2 |
Pathway | Adaptive Immune System, organism-specific biosystem; CD28 co-stimulation, organism-specific biosystem; Costimulation by the CD28 family, organism-specific biosystem; Generation of second messenger molecules, organism-specific biosystem; Immune System, organism-specific biosystem; |
Function | SH3/SH2 adaptor activity; protein binding; |
◆ Recombinant Proteins | ||
Grap2-1602M | Recombinant Mouse Grap2 protein, His & T7-tagged | +Inquiry |
GRAP2-7243M | Recombinant Mouse GRAP2 Protein | +Inquiry |
GRAP2-3432H | Recombinant Human GRB2 related adaptor protein 2 Protein, His-tagged | +Inquiry |
GRAP2-3303H | Recombinant Human GRAP2 Protein (Val77-Val325), N-His tagged | +Inquiry |
GRAP2-1969R | Recombinant Rhesus monkey GRAP2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRAP2-5757HCL | Recombinant Human GRAP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GRAP2 Products
Required fields are marked with *
My Review for All GRAP2 Products
Required fields are marked with *
0
Inquiry Basket