Recombinant Human GRIA3 protein(741-810 aa), C-His-tagged
| Cat.No. : | GRIA3-2761H |
| Product Overview : | Recombinant Human GRIA3 protein(P42263)(741-810 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 741-810 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | NEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGG |
| Gene Name | GRIA3 glutamate receptor, ionotropic, AMPA 3 [ Homo sapiens ] |
| Official Symbol | GRIA3 |
| Synonyms | GRIA3; glutamate receptor, ionotropic, AMPA 3; GLUR3, glutamate receptor, ionotrophic, AMPA 3; glutamate receptor 3; GluA3; GLURC; MRX94; gluR-3; dJ1171F9.1; glutamate receptor C; glutamate receptor subunit 3; AMPA-selective glutamate receptor 3; glutamate receptor, ionotrophic, AMPA 3; GLUR3; GLUR-C; GLUR-K3; |
| Gene ID | 2892 |
| mRNA Refseq | NM_000828 |
| Protein Refseq | NP_000819 |
| MIM | 305915 |
| UniProt ID | P42263 |
| ◆ Recombinant Proteins | ||
| GRIA3-27524TH | Recombinant Human GRIA3 | +Inquiry |
| GRIA3-2761H | Recombinant Human GRIA3 protein(741-810 aa), C-His-tagged | +Inquiry |
| GRIA3-5622HF | Recombinant Full Length Human GRIA3 Protein, GST-tagged | +Inquiry |
| GRIA3-1352H | Recombinant Human GRIA3 protein, His & T7-tagged | +Inquiry |
| GRIA3-537H | Recombinant Human GRIA3 Protein (151-250 aa), His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GRIA3-752HCL | Recombinant Human GRIA3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRIA3 Products
Required fields are marked with *
My Review for All GRIA3 Products
Required fields are marked with *
