Recombinant Human GRID2 Protein, GST-tagged

Cat.No. : GRID2-5335H
Product Overview : Human GRID2 partial ORF ( NP_001501, 908 a.a. - 1007 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Human glutamate receptor delta-2 (GRID2) is a relatively new member of the family of ionotropic glutamate receptors which are the predominant excitatory neurotransmitter receptors in the mammalian brain. GRID2 is a predicted 1,007 amino acid protein that shares 97% identity with the mouse homolog which is expressed selectively in cerebellar Purkinje cells. A point mutation in mouse GRID2, associated with the phenotype named lurcher, in the heterozygous state leads to ataxia resulting from selective, cell-autonomous apoptosis of cerebellar Purkinje cells during postnatal development. Mice homozygous for this mutation die shortly after birth from massive loss of mid- and hindbrain neurons during late embryogenesis. This strongly suggests a role for GRID2 in neuronal apoptotic death. [provided by RefSeq
Molecular Mass : 36.74 kDa
AA Sequence : DTLPTRQALEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAASGFTFGNVPEHRTGPFRHRAPNGGFFRSPIKTMSSIPYQPTPTLGLNLGNDPDRGTSI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GRID2 glutamate receptor, ionotropic, delta 2 [ Homo sapiens ]
Official Symbol GRID2
Synonyms GRID2; glutamate receptor, ionotropic, delta 2; glutamate receptor delta-2 subunit; GluD2; GluR delta 2; GluR-delta-2; gluR delta-2 subunit; MGC117022; MGC117023; MGC117024;
Gene ID 2895
mRNA Refseq NM_001510
Protein Refseq NP_001501
MIM 602368
UniProt ID O43424

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GRID2 Products

Required fields are marked with *

My Review for All GRID2 Products

Required fields are marked with *

0
cart-icon
0
compare icon