Recombinant Human GRIK1 protein(291-530 aa), C-His-tagged
| Cat.No. : | GRIK1-2748H |
| Product Overview : | Recombinant Human GRIK1 protein(P39086)(291-530 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 291-530 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | SSIIEKWSMERLQAPPRPETGLLDGMMTTEAALMYDAVYMVAIASHRASQLTVSSLQCHRHKPWRLGPRFMNLIKEARWDGLTGHITFNKTNGLRKDFDLDIISLKEEGTEKAAGEVSKHLYKVWKKIGIWNSNSGLNMTDSNKDKSSNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFIYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVA |
| Gene Name | GRIK1 glutamate receptor, ionotropic, kainate 1 [ Homo sapiens ] |
| Official Symbol | GRIK1 |
| Synonyms | GRIK1; glutamate receptor, ionotropic, kainate 1; GLUR5; glutamate receptor, ionotropic kainate 1; GluK1; gluR-5; glutamate receptor 5; excitatory amino acid receptor 3; EAA3; EEA3; GLR5; |
| Gene ID | 2897 |
| mRNA Refseq | NM_000830 |
| Protein Refseq | NP_000821 |
| MIM | 138245 |
| UniProt ID | P39086 |
| ◆ Recombinant Proteins | ||
| GRIK1-5336H | Recombinant Human GRIK1 Protein, GST-tagged | +Inquiry |
| GRIK1-312C | Recombinant Cynomolgus Monkey GRIK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GRIK1-566C | Recombinant Cynomolgus GRIK1 Protein, His-tagged | +Inquiry |
| GRIK1-2748H | Recombinant Human GRIK1 protein(291-530 aa), C-His-tagged | +Inquiry |
| GRIK1-2349R | Recombinant Rat GRIK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRIK1 Products
Required fields are marked with *
My Review for All GRIK1 Products
Required fields are marked with *
