Recombinant Human GRIK4 Protein, GST-tagged
Cat.No. : | GRIK4-5340H |
Product Overview : | Human GRIK4 partial ORF ( NP_055434, 21 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane receptors. The protein encoded by this gene forms functional heteromeric kainate-preferring ionic channels with the subunits encoded by related gene family members. [provided by RefSeq |
Molecular Mass : | 37.84 kDa |
AA Sequence : | SPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLGKAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFKVAPEEFVKFQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GRIK4 glutamate receptor, ionotropic, kainate 4 [ Homo sapiens ] |
Official Symbol | GRIK4 |
Synonyms | GRIK4; glutamate receptor, ionotropic, kainate 4; GRIK; glutamate receptor, ionotropic kainate 4; GluK4; KA1; glutamate receptor KA1; glutamate receptor KA-1; excitatory amino acid receptor 1; EAA1; |
Gene ID | 2900 |
mRNA Refseq | NM_014619 |
Protein Refseq | NP_055434 |
MIM | 600282 |
UniProt ID | Q16099 |
◆ Recombinant Proteins | ||
GRIK4-2352R | Recombinant Rat GRIK4 Protein, His (Fc)-Avi-tagged | +Inquiry |
GRIK4-5340H | Recombinant Human GRIK4 Protein, GST-tagged | +Inquiry |
GRIK4-7267M | Recombinant Mouse GRIK4 Protein | +Inquiry |
GRIK4-29879TH | Recombinant Human GRIK4 | +Inquiry |
GRIK4-2698R | Recombinant Rat GRIK4 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRIK4 Products
Required fields are marked with *
My Review for All GRIK4 Products
Required fields are marked with *