Recombinant Human GRIK4 Protein, GST-tagged

• Cat.No.: GRIK4-5340H
• Product Overview: Human GRIK4 partial ORF ( NP_055434, 21 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane receptors. The protein encoded by this gene forms functional heteromeric kainate-preferring ionic channels with the subunits encoded by related gene family members. [provided by RefSeq
• Molecular Mass: 37.84 kDa
• AA Sequence: SPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLGKAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFKVAPEEFVKFQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GRIK4 glutamate receptor, ionotropic, kainate 4 [ Homo sapiens ]
• Official Symbol: GRIK4
• Synonyms: GRIK4; glutamate receptor, ionotropic, kainate 4; GRIK; glutamate receptor, ionotropic kainate 4; GluK4; KA1; glutamate receptor KA1; glutamate receptor KA-1; excitatory amino acid receptor 1; EAA1
• Gene ID: 2900
• mRNA Refseq: NM_014619
• Protein Refseq: NP_055434
• MIM: 600282
• UniProt ID: Q16099