Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human GRIK4

Cat.No. : GRIK4-29879TH
Product Overview : Recombinant fragment of Human KA1 with a N terminal proprietary tag: predicted molecular weight 37.73 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane receptors. The protein encoded by this gene forms functional heteromeric kainate-preferring ionic channels with the subunits encoded by related gene family members.
Protein length : 110 amino acids
Molecular Weight : 37.730kDa
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLG KAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSS PASSSIISNICGEKEVPHFKVAPEEFVKFQ
Sequence Similarities : Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIK4 subfamily.
Gene Name : GRIK4 glutamate receptor, ionotropic, kainate 4 [ Homo sapiens ]
Official Symbol : GRIK4
Synonyms : GRIK4; glutamate receptor, ionotropic, kainate 4; GRIK; glutamate receptor, ionotropic kainate 4; KA1;
Gene ID : 2900
mRNA Refseq : NM_014619
Protein Refseq : NP_055434
MIM : 600282
Uniprot ID : Q16099
Chromosome Location : 11q
Pathway : Activation of Ca-permeable Kainate Receptor, organism-specific biosystem; Activation of Kainate Receptors upon glutamate binding, organism-specific biosystem; Glutamatergic synapse, organism-specific biosystem; Glutamatergic synapse, conserved biosystem; Ionotropic activity of Kainate Receptors, organism-specific biosystem;
Function : extracellular-glutamate-gated ion channel activity; ion channel activity; kainate selective glutamate receptor activity; receptor activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends