Recombinant Human GRIK4
Cat.No. : | GRIK4-29879TH |
Product Overview : | Recombinant fragment of Human KA1 with a N terminal proprietary tag: predicted molecular weight 37.73 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | This gene encodes a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane receptors. The protein encoded by this gene forms functional heteromeric kainate-preferring ionic channels with the subunits encoded by related gene family members. |
Molecular Weight : | 37.730kDa |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLG KAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSS PASSSIISNICGEKEVPHFKVAPEEFVKFQ |
Sequence Similarities : | Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIK4 subfamily. |
Gene Name | GRIK4 glutamate receptor, ionotropic, kainate 4 [ Homo sapiens ] |
Official Symbol | GRIK4 |
Synonyms | GRIK4; glutamate receptor, ionotropic, kainate 4; GRIK; glutamate receptor, ionotropic kainate 4; KA1; |
Gene ID | 2900 |
mRNA Refseq | NM_014619 |
Protein Refseq | NP_055434 |
MIM | 600282 |
Uniprot ID | Q16099 |
Chromosome Location | 11q |
Pathway | Activation of Ca-permeable Kainate Receptor, organism-specific biosystem; Activation of Kainate Receptors upon glutamate binding, organism-specific biosystem; Glutamatergic synapse, organism-specific biosystem; Glutamatergic synapse, conserved biosystem; Ionotropic activity of Kainate Receptors, organism-specific biosystem; |
Function | extracellular-glutamate-gated ion channel activity; ion channel activity; kainate selective glutamate receptor activity; receptor activity; |
◆ Recombinant Proteins | ||
GRIK4-2352R | Recombinant Rat GRIK4 Protein, His (Fc)-Avi-tagged | +Inquiry |
GRIK4-7267M | Recombinant Mouse GRIK4 Protein | +Inquiry |
GRIK4-29879TH | Recombinant Human GRIK4 | +Inquiry |
GRIK4-5340H | Recombinant Human GRIK4 Protein, GST-tagged | +Inquiry |
GRIK4-3929M | Recombinant Mouse GRIK4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GRIK4 Products
Required fields are marked with *
My Review for All GRIK4 Products
Required fields are marked with *
0
Inquiry Basket