Recombinant Human GRIK4
| Cat.No. : | GRIK4-29879TH |
| Product Overview : | Recombinant fragment of Human KA1 with a N terminal proprietary tag: predicted molecular weight 37.73 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 110 amino acids |
| Description : | This gene encodes a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane receptors. The protein encoded by this gene forms functional heteromeric kainate-preferring ionic channels with the subunits encoded by related gene family members. |
| Molecular Weight : | 37.730kDa |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | SPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLG KAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSS PASSSIISNICGEKEVPHFKVAPEEFVKFQ |
| Sequence Similarities : | Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIK4 subfamily. |
| Gene Name | GRIK4 glutamate receptor, ionotropic, kainate 4 [ Homo sapiens ] |
| Official Symbol | GRIK4 |
| Synonyms | GRIK4; glutamate receptor, ionotropic, kainate 4; GRIK; glutamate receptor, ionotropic kainate 4; KA1; |
| Gene ID | 2900 |
| mRNA Refseq | NM_014619 |
| Protein Refseq | NP_055434 |
| MIM | 600282 |
| Uniprot ID | Q16099 |
| Chromosome Location | 11q |
| Pathway | Activation of Ca-permeable Kainate Receptor, organism-specific biosystem; Activation of Kainate Receptors upon glutamate binding, organism-specific biosystem; Glutamatergic synapse, organism-specific biosystem; Glutamatergic synapse, conserved biosystem; Ionotropic activity of Kainate Receptors, organism-specific biosystem; |
| Function | extracellular-glutamate-gated ion channel activity; ion channel activity; kainate selective glutamate receptor activity; receptor activity; |
| ◆ Recombinant Proteins | ||
| GRIK4-3929M | Recombinant Mouse GRIK4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GRIK4-29879TH | Recombinant Human GRIK4 | +Inquiry |
| GRIK4-7267M | Recombinant Mouse GRIK4 Protein | +Inquiry |
| GRIK4-2698R | Recombinant Rat GRIK4 Protein | +Inquiry |
| GRIK4-5340H | Recombinant Human GRIK4 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRIK4 Products
Required fields are marked with *
My Review for All GRIK4 Products
Required fields are marked with *



