Recombinant Human GRIN1 protein, His-tagged

Cat.No. : GRIN1-2993H
Product Overview : Recombinant Human GRIN1 protein(Q05586)(834-938aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 834-938aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 18.0 kDa
AA Sequence : IAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDTSTGGGRGALQNQKDTVLPRRAIEREEGQLQLCSRHRES
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name GRIN1 glutamate receptor, ionotropic, N-methyl D-aspartate 1 [ Homo sapiens ]
Official Symbol GRIN1
Synonyms GRIN1; glutamate receptor, ionotropic, N-methyl D-aspartate 1; NMDAR1; glutamate [NMDA] receptor subunit zeta-1; GluN1; NMD-R1; glutamate [NMDA] receptor subunit zeta 1; N-methyl-D-aspartate receptor subunit NR1; N-methyl-D-aspartate receptor channel, subunit zeta-1; NR1; MRD8; NMDA1;
Gene ID 2902
mRNA Refseq NM_000832
Protein Refseq NP_000823
MIM 138249
UniProt ID Q05586

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GRIN1 Products

Required fields are marked with *

My Review for All GRIN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon