Recombinant Human GRIN1 protein, His-tagged
| Cat.No. : | GRIN1-2993H |
| Product Overview : | Recombinant Human GRIN1 protein(Q05586)(834-938aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 834-938aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 18.0 kDa |
| AA Sequence : | IAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDTSTGGGRGALQNQKDTVLPRRAIEREEGQLQLCSRHRES |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | GRIN1 glutamate receptor, ionotropic, N-methyl D-aspartate 1 [ Homo sapiens ] |
| Official Symbol | GRIN1 |
| Synonyms | GRIN1; glutamate receptor, ionotropic, N-methyl D-aspartate 1; NMDAR1; glutamate [NMDA] receptor subunit zeta-1; GluN1; NMD-R1; glutamate [NMDA] receptor subunit zeta 1; N-methyl-D-aspartate receptor subunit NR1; N-methyl-D-aspartate receptor channel, subunit zeta-1; NR1; MRD8; NMDA1; |
| Gene ID | 2902 |
| mRNA Refseq | NM_000832 |
| Protein Refseq | NP_000823 |
| MIM | 138249 |
| UniProt ID | Q05586 |
| ◆ Recombinant Proteins | ||
| GRIN1-2354R | Recombinant Rat GRIN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Grin1-1589R | Recombinant Rat Grin1 Protein, His-tagged | +Inquiry |
| GRIN1-5343H | Recombinant Human GRIN1 Protein | +Inquiry |
| GRIN1-3077H | Recombinant Human GRIN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GRIN1-418HFL | Recombinant Full Length Human GRIN1 Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GRIN1-5745HCL | Recombinant Human GRIN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRIN1 Products
Required fields are marked with *
My Review for All GRIN1 Products
Required fields are marked with *



