Recombinant Human GRIN2B protein(1251-1380 aa), C-His-tagged
Cat.No. : | GRIN2B-2848H |
Product Overview : | Recombinant Human GRIN2B protein(Q13224)(1251-1380 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1251-1380 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 17.5 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | LYDISEDNSLQELDQPAAPVAVTSNASTTKYPQSPTNSKAQKKNRNKLRRQHSYDTFVDLQKEEAALAPRSVSLKDKGRFMDGSPYAHMFEMSAGESTFANNKSSVPTAGHHHHNNPGGGYMLSKSLYPD |
Gene Name | GRIN2B glutamate receptor, ionotropic, N-methyl D-aspartate 2B [ Homo sapiens ] |
Official Symbol | GRIN2B |
Synonyms | GRIN2B; glutamate receptor, ionotropic, N-methyl D-aspartate 2B; NMDAR2B; glutamate [NMDA] receptor subunit epsilon-2; GluN2B; NR3; glutamate receptor subunit epsilon-2; N-methyl-D-aspartate receptor subunit 3; N-methyl D-aspartate receptor subtype 2B; MRD6; NR2B; hNR3; MGC142178; MGC142180; |
Gene ID | 2904 |
mRNA Refseq | NM_000834 |
Protein Refseq | NP_000825 |
MIM | 138252 |
UniProt ID | Q13224 |
◆ Recombinant Proteins | ||
GRIN2B-5345H | Recombinant Human GRIN2B Protein, GST-tagged | +Inquiry |
GRIN2B-2546H | Recombinant Human GRIN2B Protein (Tyr1133-Val1484), N-His tagged | +Inquiry |
Grin2b-2814R | Recombinant Rat Grin2b Protein, His-tagged, OVA Conjugated | +Inquiry |
GRIN2B-2848H | Recombinant Human GRIN2B protein(1251-1380 aa), C-His-tagged | +Inquiry |
GRIN2B-2355R | Recombinant Rat GRIN2B Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRIN2B Products
Required fields are marked with *
My Review for All GRIN2B Products
Required fields are marked with *