Recombinant Human GRIN2C protein, His-tagged
Cat.No. : | GRIN2C-8756H |
Product Overview : | Recombinant Human GRIN2C protein(25-104 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 25-104 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | QGEQGMTVAVVFSSSGPPQAQFRARLTPQSFLDLPLEIQPLTVGVNTTNPSSLLTQICGLLGAAHVHGIVFEDNVDTEAV |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | GRIN2C glutamate receptor, ionotropic, N-methyl D-aspartate 2C [ Homo sapiens ] |
Official Symbol | GRIN2C |
Synonyms | GRIN2C; glutamate receptor, ionotropic, N-methyl D-aspartate 2C; NMDAR2C; glutamate [NMDA] receptor subunit epsilon-3; GluN2C; N-methyl D-aspartate receptor subtype 2C; N-methyl-D-aspartate receptor subunit 2C; NR2C; |
mRNA Refseq | NM_000835 |
Protein Refseq | NP_000826 |
MIM | 138254 |
UniProt ID | Q14957 |
Gene ID | 2905 |
◆ Recombinant Proteins | ||
GRIN2C-5346H | Recombinant Human GRIN2C Protein, GST-tagged | +Inquiry |
GRIN2C-8755H | Recombinant Human GRIN2C protein, His-tagged | +Inquiry |
GRIN2C-29051TH | Recombinant Human GRIN2C, Protein A-tagged | +Inquiry |
GRIN2C-8756H | Recombinant Human GRIN2C protein, His-tagged | +Inquiry |
GRIN2C-2702R | Recombinant Rat GRIN2C Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRIN2C-5744HCL | Recombinant Human GRIN2C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GRIN2C Products
Required fields are marked with *
My Review for All GRIN2C Products
Required fields are marked with *
0
Inquiry Basket