Recombinant Human GRK5 Protein, GST-tagged
| Cat.No. : | GRK5-5356H |
| Product Overview : | Human GRK5 partial ORF ( AAH64506, 51 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs). [provided by RefSeq |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | RDYCSLCDKQPIGRLLFRQFCETRPGLECYIQFLDSVAEYEVTPDEKLGEKGKEIMTKYLTPKSPVFIAQVGQDLVSQTEEKLLQKPCKELFSACAQSVH |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GRK5 G protein-coupled receptor kinase 5 [ Homo sapiens ] |
| Official Symbol | GRK5 |
| Synonyms | GRK5; G protein-coupled receptor kinase 5; GPRK5; FP2025; g protein-coupled receptor kinase GRK5; FLJ39780; |
| Gene ID | 2869 |
| mRNA Refseq | NM_005308 |
| Protein Refseq | NP_005299 |
| MIM | 600870 |
| UniProt ID | P34947 |
| ◆ Recombinant Proteins | ||
| Grk5-1051M | Recombinant Mouse Grk5 Protein, MYC/DDK-tagged | +Inquiry |
| GRK5-760H | Recombinant Human GRK5 protein(Met1-Ser590), His-tagged | +Inquiry |
| GRK5-1735H | Recombinant Human GRK5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| GRK5-13541H | Recombinant Human GRK5, His-tagged | +Inquiry |
| GRK5-324H | Recombinant Human GRK5, GST-tagged, Active | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GRK5-640HCL | Recombinant Human GRK5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRK5 Products
Required fields are marked with *
My Review for All GRK5 Products
Required fields are marked with *
