Recombinant Human GRK5 Protein, GST-tagged

Cat.No. : GRK5-5356H
Product Overview : Human GRK5 partial ORF ( AAH64506, 51 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs). [provided by RefSeq
Molecular Mass : 36.63 kDa
AA Sequence : RDYCSLCDKQPIGRLLFRQFCETRPGLECYIQFLDSVAEYEVTPDEKLGEKGKEIMTKYLTPKSPVFIAQVGQDLVSQTEEKLLQKPCKELFSACAQSVH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GRK5 G protein-coupled receptor kinase 5 [ Homo sapiens ]
Official Symbol GRK5
Synonyms GRK5; G protein-coupled receptor kinase 5; GPRK5; FP2025; g protein-coupled receptor kinase GRK5; FLJ39780;
Gene ID 2869
mRNA Refseq NM_005308
Protein Refseq NP_005299
MIM 600870
UniProt ID P34947

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GRK5 Products

Required fields are marked with *

My Review for All GRK5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon