Recombinant Human GRM1 protein(881-960 aa), C-His-tagged
Cat.No. : | GRM1-2851H |
Product Overview : | Recombinant Human GRM1 protein(Q13255)(881-960 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 881-960 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 10.5 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | AGAGNANSNGKSVSWSEPGGGQVPKGQHMWHRLSVHVKTNETACNQTAVIKPLTKSYQGSGKSLTFSDTSTKTLYNVEEE |
Gene Name | GRM1 glutamate receptor, metabotropic 1 [ Homo sapiens ] |
Official Symbol | GRM1 |
Synonyms | GRM1; glutamate receptor, metabotropic 1; metabotropic glutamate receptor 1; GPRC1A; mGlu1; MGLUR1; GRM1A; MGLUR1A; |
Gene ID | 2911 |
mRNA Refseq | NM_000838 |
Protein Refseq | NP_000829 |
MIM | 604473 |
UniProt ID | Q13255 |
◆ Recombinant Proteins | ||
GRM1-3939M | Recombinant Mouse GRM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GRM1-1976R | Recombinant Rhesus monkey GRM1 Protein, His-tagged | +Inquiry |
GRM1-2713R | Recombinant Rat GRM1 Protein | +Inquiry |
GRM1-2851H | Recombinant Human GRM1 protein(881-960 aa), C-His-tagged | +Inquiry |
GRM1-2548H | Recombinant Human GRM1 Protein (Ser165-Glu592), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRM1-5737HCL | Recombinant Human GRM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRM1 Products
Required fields are marked with *
My Review for All GRM1 Products
Required fields are marked with *