Recombinant Human GRM1 protein(881-960 aa), C-His-tagged

Cat.No. : GRM1-2851H
Product Overview : Recombinant Human GRM1 protein(Q13255)(881-960 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 881-960 aa
Form : 0.15 M Phosphate buffered saline
Molecular Mass : 10.5 kDa
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : AGAGNANSNGKSVSWSEPGGGQVPKGQHMWHRLSVHVKTNETACNQTAVIKPLTKSYQGSGKSLTFSDTSTKTLYNVEEE
Gene Name GRM1 glutamate receptor, metabotropic 1 [ Homo sapiens ]
Official Symbol GRM1
Synonyms GRM1; glutamate receptor, metabotropic 1; metabotropic glutamate receptor 1; GPRC1A; mGlu1; MGLUR1; GRM1A; MGLUR1A;
Gene ID 2911
mRNA Refseq NM_000838
Protein Refseq NP_000829
MIM 604473
UniProt ID Q13255

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GRM1 Products

Required fields are marked with *

My Review for All GRM1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon