Recombinant Human GRM1 protein, GST-tagged
Cat.No. : | GRM1-29607TH |
Product Overview : | Recombinant Human GRM1(387 a.a. - 486 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 387-486 a.a. |
Description : | This gene encodes a metabotropic glutamate receptor that functions by activating phospholipase C. L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The canonical alpha isoform of the encoded protein is a disulfide-linked homodimer whose activity is mediated by a G-protein-coupled phosphatidylinositol-calcium second messenger system. This gene may be associated with many disease states, including schizophrenia, bipolar disorder, depression, and breast cancer. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | NPNFKRICTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHVGLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFDEKGDAPGRYDIMNLQY |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | GRM1 glutamate receptor, metabotropic 1 [ Homo sapiens ] |
Official Symbol | GRM1 |
Synonyms | GRM1; glutamate receptor, metabotropic 1; metabotropic glutamate receptor 1; GPRC1A; mGlu1; MGLUR1; GRM1A; MGLUR1A; |
Gene ID | 2911 |
mRNA Refseq | NM_000838 |
Protein Refseq | NP_000829 |
MIM | 604473 |
UniProt ID | Q13255 |
Chromosome Location | 6q24 |
Pathway | Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Class C/3 (Metabotropic glutamate/pheromone receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class C Metabotropic glutamate, pheromone, organism-specific biosystem; GPCRs, Other, organism-specific biosystem; Gap junction, organism-specific biosystem; |
Function | G-protein coupled receptor activity; estrogen receptor binding; glutamate receptor activity; receptor activity; signal transducer activity; |
◆ Recombinant Proteins | ||
GRM1-2548H | Recombinant Human GRM1 Protein (Ser165-Glu592), N-His tagged | +Inquiry |
GRM1-7284M | Recombinant Mouse GRM1 Protein | +Inquiry |
GRM1-3939M | Recombinant Mouse GRM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GRM1-29607TH | Recombinant Human GRM1 protein, GST-tagged | +Inquiry |
GRM1-2367R | Recombinant Rat GRM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRM1-5737HCL | Recombinant Human GRM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GRM1 Products
Required fields are marked with *
My Review for All GRM1 Products
Required fields are marked with *
0
Inquiry Basket