Recombinant Human GRM1 protein, GST-tagged

Cat.No. : GRM1-29607TH
Product Overview : Recombinant Human GRM1(387 a.a. - 486 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 387-486 a.a.
Description : This gene encodes a metabotropic glutamate receptor that functions by activating phospholipase C. L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The canonical alpha isoform of the encoded protein is a disulfide-linked homodimer whose activity is mediated by a G-protein-coupled phosphatidylinositol-calcium second messenger system. This gene may be associated with many disease states, including schizophrenia, bipolar disorder, depression, and breast cancer. Alternative splicing results in multiple transcript variants encoding different isoforms.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : NPNFKRICTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHVGLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFDEKGDAPGRYDIMNLQY
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name GRM1 glutamate receptor, metabotropic 1 [ Homo sapiens ]
Official Symbol GRM1
Synonyms GRM1; glutamate receptor, metabotropic 1; metabotropic glutamate receptor 1; GPRC1A; mGlu1; MGLUR1; GRM1A; MGLUR1A;
Gene ID 2911
mRNA Refseq NM_000838
Protein Refseq NP_000829
MIM 604473
UniProt ID Q13255
Chromosome Location 6q24
Pathway Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Class C/3 (Metabotropic glutamate/pheromone receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class C Metabotropic glutamate, pheromone, organism-specific biosystem; GPCRs, Other, organism-specific biosystem; Gap junction, organism-specific biosystem;
Function G-protein coupled receptor activity; estrogen receptor binding; glutamate receptor activity; receptor activity; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GRM1 Products

Required fields are marked with *

My Review for All GRM1 Products

Required fields are marked with *

0
cart-icon