"GRM3" Related Products

Expand
Expand

Recombinant Human GRM3 protein

Cat.No. : GRM3-29610TH
Product Overview : Recombinant Human GRM3 was expressed in Wheat Germ.
Description : L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5 and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3 while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities.
Source : Wheat Germ
Species : Human
Form : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Molecular Mass : 98.9 kDa
AA Sequence : MKMLTRLQVLTLALFSKGFLLSLGDHNFLRREIKIEGDLVLGGLFPINEKGTGTEECGRINEDRGIQRLEAMLFA IDEINKDDYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLTKVDEAEYMCPDGSYAIQENIPLLIAGVIGGSY SSVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGET GIEAFEQEARLRNICIATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAASRANASFTWVAS DGWGAQESIIKGSEHVAYGAITLELASQPVRQFDRYFQSLNPYNNHRNPWFRDFWEQKFQCSLQNKRNHRRVCDK HLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPNTTKLCDAMKILDGKKLYKDYLLKINFTAPFNPNKDA DSIVKFDTFGDGMGRYNVFNFQNVGGKYSYLKVGHWAETLSLDVNSIHWSRNSVPTSQCSDPCAPNEMKNMQPGD VCCWICIPCEPYEYLADEFTCMDCGSGQWPTADLTGCYDLPEDYIRWEDAWAIGPVTIACLGFMCTCMVVTVFIK HNNTPLVKASGRELCYILLFGVGLSYCMTFFFIAKPSPVICALRRLGLGSSFAICYSALLTKTNCIARIFDGVKN GAQRPKFISPSSQVFICLGLILVQIVMVSVWLILEAPGTRRYTLAEKRETVILKCNVKDSSMLISLTYDVILVIL CTVYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLFAPKVHI ILFQPQKNVVTHRLHLNRFSVSGTGTTYSQSSASTYVPTVCNGREVLDSTTSSL
Applications : Antibody Production;Functional Study: Recommended usage only, not validated yet.Compound Screening: Recommended usage only, not validated yet.
Notes : Best use within three months from the date of receipt of this protein. Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : GRM3 glutamate receptor, metabotropic 3 [ Homo sapiens ]
Official Symbol : GRM3
Synonyms : GRM3; glutamate receptor, metabotropic 3; metabotropic glutamate receptor 3; GPRC1C; mGlu3; MGLUR3; glutamate metabotropic receptor 3; GLUR3;
Gene ID : 2913
mRNA Refseq : NM_000840
Protein Refseq : NP_000831
MIM : 601115
UniProt ID : Q14832
Chromosome Location : 7q21.1-q21.2
Pathway : Class C/3 (Metabotropic glutamate/pheromone receptors), organism-specific biosystem; Cocaine addiction, organism-specific biosystem; Cocaine addiction, conserved biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class C Metabotropic glutamate, pheromone, organism-specific biosystem; Glutamatergic synapse, organism-specific biosystem; Glutamatergic synapse, conserved biosystem;
Function : G-protein coupled receptor activity; G-protein coupled receptor activity; calcium channel regulator activity; glutamate receptor activity; group II metabotropic glutamate receptor activity; receptor activity; signal transducer activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.