Recombinant Human GRM3 protein
Cat.No. : | GRM3-29610TH |
Product Overview : | Recombinant Human GRM3 was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5 and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3 while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities. |
Form : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Molecular Mass : | 98.9 kDa |
AA Sequence : | MKMLTRLQVLTLALFSKGFLLSLGDHNFLRREIKIEGDLVLGGLFPINEKGTGTEECGRINEDRGIQRLEAMLFA IDEINKDDYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLTKVDEAEYMCPDGSYAIQENIPLLIAGVIGGSY SSVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGET GIEAFEQEARLRNICIATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAASRANASFTWVAS DGWGAQESIIKGSEHVAYGAITLELASQPVRQFDRYFQSLNPYNNHRNPWFRDFWEQKFQCSLQNKRNHRRVCDK HLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPNTTKLCDAMKILDGKKLYKDYLLKINFTAPFNPNKDA DSIVKFDTFGDGMGRYNVFNFQNVGGKYSYLKVGHWAETLSLDVNSIHWSRNSVPTSQCSDPCAPNEMKNMQPGD VCCWICIPCEPYEYLADEFTCMDCGSGQWPTADLTGCYDLPEDYIRWEDAWAIGPVTIACLGFMCTCMVVTVFIK HNNTPLVKASGRELCYILLFGVGLSYCMTFFFIAKPSPVICALRRLGLGSSFAICYSALLTKTNCIARIFDGVKN GAQRPKFISPSSQVFICLGLILVQIVMVSVWLILEAPGTRRYTLAEKRETVILKCNVKDSSMLISLTYDVILVIL CTVYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLFAPKVHI ILFQPQKNVVTHRLHLNRFSVSGTGTTYSQSSASTYVPTVCNGREVLDSTTSSL |
Applications : | Antibody Production;Functional Study: Recommended usage only, not validated yet.Compound Screening: Recommended usage only, not validated yet. |
Notes : | Best use within three months from the date of receipt of this protein. Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | GRM3 glutamate receptor, metabotropic 3 [ Homo sapiens ] |
Official Symbol | GRM3 |
Synonyms | GRM3; glutamate receptor, metabotropic 3; metabotropic glutamate receptor 3; GPRC1C; mGlu3; MGLUR3; glutamate metabotropic receptor 3; GLUR3; |
Gene ID | 2913 |
mRNA Refseq | NM_000840 |
Protein Refseq | NP_000831 |
MIM | 601115 |
UniProt ID | Q14832 |
Chromosome Location | 7q21.1-q21.2 |
Pathway | Class C/3 (Metabotropic glutamate/pheromone receptors), organism-specific biosystem; Cocaine addiction, organism-specific biosystem; Cocaine addiction, conserved biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class C Metabotropic glutamate, pheromone, organism-specific biosystem; Glutamatergic synapse, organism-specific biosystem; Glutamatergic synapse, conserved biosystem; |
Function | G-protein coupled receptor activity; G-protein coupled receptor activity; calcium channel regulator activity; glutamate receptor activity; group II metabotropic glutamate receptor activity; receptor activity; signal transducer activity; |
◆ Recombinant Proteins | ||
GRM3-3941M | Recombinant Mouse GRM3 Protein, His (Fc)-Avi-tagged | +Inquiry |
GRM3-1141HFL | Recombinant Human GRM3 protein, His&Flag-tagged | +Inquiry |
GRM3-29610TH | Recombinant Human GRM3 protein | +Inquiry |
GRM3-2715R | Recombinant Rat GRM3 Protein | +Inquiry |
GRM3-1941H | Recombinant Human GRM3 protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRM3-5735HCL | Recombinant Human GRM3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRM3 Products
Required fields are marked with *
My Review for All GRM3 Products
Required fields are marked with *
0
Inquiry Basket