Recombinant Human GRM3 Protein, GST-tagged
Cat.No. : | GRM3-5366H |
Product Overview : | Human GRM3 partial ORF ( NP_000831, 21 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5 and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3 while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities. [provided by RefSeq |
Molecular Mass : | 36.74 kDa |
AA Sequence : | LSLGDHNFLRREIKIEGDLVLGGLFPINEKGTGTEECGRINEDRGIQRLEAMLFAIDEINKDDYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLTKV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GRM3 glutamate receptor, metabotropic 3 [ Homo sapiens ] |
Official Symbol | GRM3 |
Synonyms | GRM3; glutamate receptor, metabotropic 3; metabotropic glutamate receptor 3; GPRC1C; mGlu3; MGLUR3; glutamate metabotropic receptor 3; GLUR3; |
Gene ID | 2913 |
mRNA Refseq | NM_000840 |
Protein Refseq | NP_000831 |
MIM | 601115 |
UniProt ID | Q14832 |
◆ Recombinant Proteins | ||
GRM3-1941H | Recombinant Human GRM3 protein, His & GST-tagged | +Inquiry |
GRM3-2549H | Recombinant Human GRM3 Protein (Asp568-Phe819), N-GST tagged | +Inquiry |
GRM3-1141HFL | Recombinant Human GRM3 protein, His&Flag-tagged | +Inquiry |
GRM3-29610TH | Recombinant Human GRM3 protein | +Inquiry |
GRM3-6856Z | Recombinant Zebrafish GRM3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRM3-5735HCL | Recombinant Human GRM3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GRM3 Products
Required fields are marked with *
My Review for All GRM3 Products
Required fields are marked with *
0
Inquiry Basket