Recombinant Human GRM3 Protein, GST-tagged

Cat.No. : GRM3-5366H
Product Overview : Human GRM3 partial ORF ( NP_000831, 21 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5 and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3 while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities. [provided by RefSeq
Molecular Mass : 36.74 kDa
AA Sequence : LSLGDHNFLRREIKIEGDLVLGGLFPINEKGTGTEECGRINEDRGIQRLEAMLFAIDEINKDDYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLTKV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GRM3 glutamate receptor, metabotropic 3 [ Homo sapiens ]
Official Symbol GRM3
Synonyms GRM3; glutamate receptor, metabotropic 3; metabotropic glutamate receptor 3; GPRC1C; mGlu3; MGLUR3; glutamate metabotropic receptor 3; GLUR3;
Gene ID 2913
mRNA Refseq NM_000840
Protein Refseq NP_000831
MIM 601115
UniProt ID Q14832

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GRM3 Products

Required fields are marked with *

My Review for All GRM3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon