Recombinant Human GRM8
Cat.No. : | GRM8-28274TH |
Product Overview : | Recombinant fragment corresponding to amino acids 486-575 of Human Metabotropic Glutamate Receptor 8 with an N terminal proprietary tag; Predicted MWt 35.53 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 90 amino acids |
Description : | L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5 and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3 while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
Molecular Weight : | 35.530kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KVIGHWTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCCWHCERCEGYNYQVDELSCELCPLDQRPNMNRTGCQLIPII |
Sequence Similarities : | Belongs to the G-protein coupled receptor 3 family. |
Gene Name | GRM8 glutamate receptor, metabotropic 8 [ Homo sapiens ] |
Official Symbol | GRM8 |
Synonyms | GRM8; glutamate receptor, metabotropic 8; metabotropic glutamate receptor 8; GLUR8; GPRC1H; mGlu8; MGLUR8; |
Gene ID | 2918 |
mRNA Refseq | NM_000845 |
Protein Refseq | NP_000836 |
MIM | 601116 |
Uniprot ID | O00222 |
Chromosome Location | 7q31.3-q32.1 |
Pathway | Class C/3 (Metabotropic glutamate/pheromone receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class C Metabotropic glutamate, pheromone, organism-specific biosystem; GPCRs, Other, organism-specific biosystem; Glutamatergic synapse, organism-specific biosystem; |
Function | G-protein coupled receptor activity; glutamate receptor activity; group III metabotropic glutamate receptor activity; receptor activity; signal transducer activity; |
◆ Recombinant Proteins | ||
GRM8-28274TH | Recombinant Human GRM8 | +Inquiry |
GRM8-13546H | Recombinant Human GRM8 protein, His-tagged | +Inquiry |
GRM8-2373R | Recombinant Rat GRM8 Protein, His (Fc)-Avi-tagged | +Inquiry |
GRM8-2719R | Recombinant Rat GRM8 Protein | +Inquiry |
GRM8-1799R | Recombinant Rhesus Macaque GRM8 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRM8-5731HCL | Recombinant Human GRM8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GRM8 Products
Required fields are marked with *
My Review for All GRM8 Products
Required fields are marked with *
0
Inquiry Basket