Recombinant Human GRM8

Cat.No. : GRM8-28274TH
Product Overview : Recombinant fragment corresponding to amino acids 486-575 of Human Metabotropic Glutamate Receptor 8 with an N terminal proprietary tag; Predicted MWt 35.53 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 90 amino acids
Description : L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5 and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3 while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Molecular Weight : 35.530kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KVIGHWTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCCWHCERCEGYNYQVDELSCELCPLDQRPNMNRTGCQLIPII
Sequence Similarities : Belongs to the G-protein coupled receptor 3 family.
Gene Name GRM8 glutamate receptor, metabotropic 8 [ Homo sapiens ]
Official Symbol GRM8
Synonyms GRM8; glutamate receptor, metabotropic 8; metabotropic glutamate receptor 8; GLUR8; GPRC1H; mGlu8; MGLUR8;
Gene ID 2918
mRNA Refseq NM_000845
Protein Refseq NP_000836
MIM 601116
Uniprot ID O00222
Chromosome Location 7q31.3-q32.1
Pathway Class C/3 (Metabotropic glutamate/pheromone receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class C Metabotropic glutamate, pheromone, organism-specific biosystem; GPCRs, Other, organism-specific biosystem; Glutamatergic synapse, organism-specific biosystem;
Function G-protein coupled receptor activity; glutamate receptor activity; group III metabotropic glutamate receptor activity; receptor activity; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GRM8 Products

Required fields are marked with *

My Review for All GRM8 Products

Required fields are marked with *

0
cart-icon