Recombinant Human GRP protein, His-tagged
| Cat.No. : | GRP-7545H |
| Product Overview : | Recombinant Human GRP protein(49-120 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Tag : | His |
| Protein Length : | 49-120 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | LMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFK |
| Gene Name | GRP gastrin-releasing peptide [ Homo sapiens ] |
| Official Symbol | GRP |
| Synonyms | GRP; gastrin-releasing peptide; bombesin; neuromedin C; pre-progastrin releasing peptide; BN; GRP-10; proGRP; preproGRP; |
| Gene ID | 2922 |
| mRNA Refseq | NM_001012512 |
| Protein Refseq | NP_001012530 |
| MIM | 137260 |
| UniProt ID | P07492 |
| ◆ Recombinant Proteins | ||
| GRP-5417H | Recombinant Human GRP protein, GST-tagged | +Inquiry |
| GRP-5236C | Recombinant Chicken GRP | +Inquiry |
| GRP-1199H | Recombinant Human GRP Protein, His-tagged | +Inquiry |
| GRP-13547H | Recombinant Human GRP protein, His-tagged | +Inquiry |
| GRP-1594H | Recombinant Human GRP Protein, His&GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GRP-5730HCL | Recombinant Human GRP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRP Products
Required fields are marked with *
My Review for All GRP Products
Required fields are marked with *
