Recombinant Human GSDMD (1-257 aa), C-His-tagged

• Cat.No.: GSDMD-13H
• Product Overview: Recombinant Human GSDMD (1-257 aa) with C-His-tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-257 aa
• Description: Gasdermin D is a member of the gasdermin family. Members of this family appear to play a role in regulation of epithelial proliferation. Gasdermin D has been suggested to act as a tumor suppressor. Alternatively spliced transcript variants have been described.
• Form: Sterile PBS, pH7.4, 0.1% SKL
• Molecular Mass: 29 kDa
• AASequence: MGSAFERVVRRVVQELDHGGEFIPVTSLQSSTGFQPYCLVVRKPSSSWFWKPRYKCVNLSIKDILEPDAAEPDVQRGRSFHFYDAMDGQIQGSVELAAPGQAKIAGGAAVSDSSSTSMNVYSLSVDPNTWQTLLHERHLRQPEHKVLQQLRSRGDNVYVVTEVLQTQKEVEVTRTHKREGSGRFSLPGATCLQGEGQGHLSQKKTVTIPSGSTLAFRVAQLVIDSDLDVLLFPDKKQRTFQPPATGHKRSTSEGAWPHHHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.3 mg/mL by BCA

Gene Information

• Gene Name: GSDMD gasdermin D [ Homo sapiens (human) ]
• Official Symbol: GSDMD
• Synonyms: GSDMD; gasdermin D; DF5L; DFNA5L; FKSG10; GSDMDC1; gasdermin-D; gasdermin domain containing 1; gasdermin domain-containing protein 1
• Gene ID: 79792
• mRNA Refseq: NM_024736
• Protein Refseq: NP_079012
• MIM: 617042
• UniProt ID: P57764