Recombinant Human GSDMD (1-257 aa), C-His-tagged
| Cat.No. : | GSDMD-13H |
| Product Overview : | Recombinant Human GSDMD (1-257 aa) with C-His-tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-257 aa |
| Description : | Gasdermin D is a member of the gasdermin family. Members of this family appear to play a role in regulation of epithelial proliferation. Gasdermin D has been suggested to act as a tumor suppressor. Alternatively spliced transcript variants have been described. |
| Form : | Sterile PBS, pH7.4, 0.1% SKL |
| Molecular Mass : | 29 kDa |
| AASequence : | MGSAFERVVRRVVQELDHGGEFIPVTSLQSSTGFQPYCLVVRKPSSSWFWKPRYKCVNLSIKDILEPDAAEPDVQRGRSFHFYDAMDGQIQGSVELAAPGQAKIAGGAAVSDSSSTSMNVYSLSVDPNTWQTLLHERHLRQPEHKVLQQLRSRGDNVYVVTEVLQTQKEVEVTRTHKREGSGRFSLPGATCLQGEGQGHLSQKKTVTIPSGSTLAFRVAQLVIDSDLDVLLFPDKKQRTFQPPATGHKRSTSEGAWPHHHHHHHHHH |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.3 mg/mL by BCA |
| Gene Name | GSDMD gasdermin D [ Homo sapiens (human) ] |
| Official Symbol | GSDMD |
| Synonyms | GSDMD; gasdermin D; DF5L; DFNA5L; FKSG10; GSDMDC1; gasdermin-D; gasdermin domain containing 1; gasdermin domain-containing protein 1 |
| Gene ID | 79792 |
| mRNA Refseq | NM_024736 |
| Protein Refseq | NP_079012 |
| MIM | 617042 |
| UniProt ID | P57764 |
| ◆ Recombinant Proteins | ||
| GSDMD-2823H | Recombinant Human GSDMD Protein (Pro278-His484), N-His tagged | +Inquiry |
| GSDMD-7844H | Recombinant Human GSDMD protein, GST-tagged | +Inquiry |
| GSDMD-3957M | Recombinant Mouse GSDMD Protein, His (Fc)-Avi-tagged | +Inquiry |
| GSDMD-28H | Recombinant Human GSDMD Protein, His/GST-tagged | +Inquiry |
| GSDMD-7846H | Recombinant Human GSDMD protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GSDMD-5725HCL | Recombinant Human GSDMD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSDMD Products
Required fields are marked with *
My Review for All GSDMD Products
Required fields are marked with *



