Recombinant Human GSDMD protein, GST-tagged
Cat.No. : | GSDMD-7846H |
Product Overview : | Recombinant Human GSDMD protein(200-300 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Tag : | GST |
Protein Length : | 200-300 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | LSQKKTVTIPSGSTLAFRVAQLVIDSDLDVLLFPDKKQRTFQPPATGHKRSTSEGAWPQLPSGLSMMRCLHNFLTDGVPAEGAFTEDFQGLRAEVETISKE |
Gene Name | GSDMD gasdermin D [ Homo sapiens ] |
Official Symbol | GSDMD |
Synonyms | GSDMD; gasdermin D; gasdermin domain containing 1 , GSDMDC1; gasdermin-D; DF5L; FLJ12150; gasdermin domain containing 1; gasdermin domain-containing protein 1; DFNA5L; FKSG10; GSDMDC1; |
Gene ID | 79792 |
mRNA Refseq | NM_001166237 |
Protein Refseq | NP_001159709 |
UniProt ID | P57764 |
◆ Recombinant Proteins | ||
GSDMD-3957M | Recombinant Mouse GSDMD Protein, His (Fc)-Avi-tagged | +Inquiry |
GSDMD-2823H | Recombinant Human GSDMD Protein (Pro278-His484), N-His tagged | +Inquiry |
Gsdmd-8544M | Recombinant Mouse Gsdmd protein, GST-tagged | +Inquiry |
GSDMD-643H | Recombinant Human GSDMD protein, MBP&His-Avi-tagged, Biotinylated | +Inquiry |
GSDMD-2218H | Recombinant Human GSDMD Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSDMD-5725HCL | Recombinant Human GSDMD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSDMD Products
Required fields are marked with *
My Review for All GSDMD Products
Required fields are marked with *