Recombinant Human GSG1 Protein, GST-tagged
| Cat.No. : | GSG1-4392H |
| Product Overview : | Human GSG1 full-length ORF ( AAH01796.1, 1 a.a. - 282 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | GSG1 (Germ Cell Associated 1) is a Protein Coding gene. GO annotations related to this gene include RNA polymerase binding. An important paralog of this gene is GSG1L. |
| Molecular Mass : | 57.5 kDa |
| AA Sequence : | MELSKAFSGQRTLLSAILSMLSLSFSTTSLLSNYWFVGTQKVPKPLCEKGLAAKCFDMPVSLDGDTNTSTQEVVQYNWETGDDRFSFRSFRSGMWLSCEETVEEPGERCRSFIELTPPAKRGEKGLLEFATLQGPCHPTLRFGGKRLMEKASLPSPPLGLCGKNPMVIPGNADHLHRTSIHQLPPATNRLATHWEPCLWAQTERLCCCFLCPVRSPGDGGPHDVFTSLPSDCQLGSRRLETTCLELWLGLLHGLALLHLLHGVGCHHLQHVHQDGAGVQVQA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GSG1 germ cell associated 1 [ Homo sapiens ] |
| Official Symbol | GSG1 |
| Synonyms | GSG1; germ cell associated 1; germ cell-specific gene 1 protein; MGC3146; MGC111023; |
| Gene ID | 83445 |
| mRNA Refseq | NM_001080554 |
| Protein Refseq | NP_001074023 |
| UniProt ID | Q2KHT4 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSG1 Products
Required fields are marked with *
My Review for All GSG1 Products
Required fields are marked with *
