Recombinant Human GSG1 Protein, GST-tagged
Cat.No. : | GSG1-4392H |
Product Overview : | Human GSG1 full-length ORF ( AAH01796.1, 1 a.a. - 282 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | GSG1 (Germ Cell Associated 1) is a Protein Coding gene. GO annotations related to this gene include RNA polymerase binding. An important paralog of this gene is GSG1L. |
Molecular Mass : | 57.5 kDa |
AA Sequence : | MELSKAFSGQRTLLSAILSMLSLSFSTTSLLSNYWFVGTQKVPKPLCEKGLAAKCFDMPVSLDGDTNTSTQEVVQYNWETGDDRFSFRSFRSGMWLSCEETVEEPGERCRSFIELTPPAKRGEKGLLEFATLQGPCHPTLRFGGKRLMEKASLPSPPLGLCGKNPMVIPGNADHLHRTSIHQLPPATNRLATHWEPCLWAQTERLCCCFLCPVRSPGDGGPHDVFTSLPSDCQLGSRRLETTCLELWLGLLHGLALLHLLHGVGCHHLQHVHQDGAGVQVQA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GSG1 germ cell associated 1 [ Homo sapiens ] |
Official Symbol | GSG1 |
Synonyms | GSG1; germ cell associated 1; germ cell-specific gene 1 protein; MGC3146; MGC111023; |
Gene ID | 83445 |
mRNA Refseq | NM_001080554 |
Protein Refseq | NP_001074023 |
UniProt ID | Q2KHT4 |
◆ Recombinant Proteins | ||
GSG1-4392H | Recombinant Human GSG1 Protein, GST-tagged | +Inquiry |
GSG1-13559H | Recombinant Human GSG1, GST-tagged | +Inquiry |
GSG1-2380R | Recombinant Rat GSG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GSG1-7314M | Recombinant Mouse GSG1 Protein | +Inquiry |
RFL24455BF | Recombinant Full Length Bovine Germ Cell-Specific Gene 1 Protein(Gsg1) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSG1 Products
Required fields are marked with *
My Review for All GSG1 Products
Required fields are marked with *