Recombinant Human GSN protein, T7/His-tagged
Cat.No. : | GSN-201H |
Product Overview : | Recombinant human GSN (730 aa, Isoform-b, derived from BC026033) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 730 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT . |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFDVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVIL KTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVA SGFKHVVPNEVVVQRLFQVKGRRVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIR DNERSGRARVHVSEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVADENPFAQ GALKSEDCFILDHGKDGKIFVWKGKQANTEERKAALKTASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKNWRD PDQTDGLGLSYLSSHIANVERVPFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDS YIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYK GGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLR VLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDV MLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPL DRAMAELAA |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | GSN gelsolin [ Homo sapiens ] |
Official Symbol | GSN |
Synonyms | GSN; gelsolin; gelsolin (amyloidosis, Finnish type); amyloidosis; Finnish type; DKFZp313L0718; brevin; actin-depolymerizing factor; ADF; AGEL; |
Gene ID | 2934 |
mRNA Refseq | NM_000177 |
Protein Refseq | NP_000168 |
MIM | 137350 |
UniProt ID | P06396 |
Chromosome Location | 9q33 |
Pathway | Amyloids, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptotic cleavage of cellular proteins, organism-specific biosystem; Apoptotic executionphase, organism-specific biosystem; Caspase cascade in apoptosis, organism-specific biosystem; Caspase-mediated cleavage of cytoskeletal proteins, organism-specific biosystem; Coregulation of Androgen receptor activity, organism-specific biosystem; |
Function | actin binding; calcium ion binding; protein binding; |
◆ Recombinant Proteins | ||
Gsn-532M | Recombinant Mouse Gsn Protein, His-tagged | +Inquiry |
GSN-13H | Active Recombinant Human GSN Protein (125-150aa), N-6×His-tagged | +Inquiry |
GSN-2221H | Recombinant Human GSN Protein, His-tagged | +Inquiry |
GSN-2384R | Recombinant Rat GSN Protein, His (Fc)-Avi-tagged | +Inquiry |
GSN-004H | Recombinant Human GSN Protein | +Inquiry |
◆ Native Proteins | ||
GSN-876P | Active Native Porcine GSN Protein | +Inquiry |
GSN-875B | Active Native Bovine GSN Protein | +Inquiry |
GSN-874P | Active Native Porcine GSN Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSN-5722HCL | Recombinant Human GSN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSN Products
Required fields are marked with *
My Review for All GSN Products
Required fields are marked with *