Recombinant Human GSPT1 protein, GST-tagged
Cat.No. : | GSPT1-940H |
Product Overview : | Recombinant Human GSPT1 protein (294-499 aa) was fused to GST-tag and expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 206 |
Description : | Involved in translation termination in response to the termination codons UAA, UAG and UGA. Stimulates the activity of ETF1. Involved in regulation of mammalian cell growth. Component of the transient SURF complex which recruits UPF1 to stalled ribosomes in the context of nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. Required for SHFL-mediated translation termination which inhibits programmed ribosomal frameshifting (-1PRF) of mRNA from viruses and cellular genes. |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5% trehalose and 5% mannitol are added as protectants before lyophilization. |
Molecular Mass : | 49 kDa |
AA Sequence : | FNRSVDGPIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVPEKD |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder. Storage of Reconstituted Protein: Short-term storage: Store at 2-8 centigrade for (1-2 weeks); Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |
Gene Name | GSPT1 |
Official Symbol | GSPT1 |
Synonyms | GST1; ETF3A; eRF3a; 551G9.2 |
Gene ID | 2935 |
mRNA Refseq | NM_002094.4 |
Protein Refseq | NP_002085.3 |
MIM | 139259 |
UniProt ID | P15170 |
◆ Recombinant Proteins | ||
GSPT1-2473H | Recombinant Human GSPT1 Protein (1-499 aa), His-Myc-tagged | +Inquiry |
GSPT1-940H | Recombinant Human GSPT1 protein, GST-tagged | +Inquiry |
GSPT1-2225H | Recombinant Human GSPT1 protein, MBP&His-tagged | +Inquiry |
GSPT1-909H | Recombinant Human GSPT1 protein, GST-tagged | +Inquiry |
GSPT1-1191Z | Recombinant Zebrafish GSPT1 | +Inquiry |
◆ Native Proteins | ||
GSPT1-12HFL | Recombinant Full Length Human GSPT1 Protein, Avi tagged, Biotin Labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GSPT1 Products
Required fields are marked with *
My Review for All GSPT1 Products
Required fields are marked with *
0
Inquiry Basket