Recombinant Human GSTA3 protein, GST-tagged

Cat.No. : GSTA3-242H
Product Overview : Recombinant Human GSTA3 protein(NP_000838)(1-222 aa), fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-222 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGIKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRF
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
Gene Name GSTA3 glutathione S-transferase alpha 3 [ Homo sapiens ]
Official Symbol GSTA3
Synonyms GSTA3; glutathione S-transferase alpha 3; glutathione S transferase A3; glutathione S-transferase A3; GST class-alpha member 3; glutathione S-transferase A3-3; glutathione S-aryltransferase A3; glutathione S-alkyltransferase A3; glutathione S-aralkyltransferase A3; S-(hydroxyalkyl)glutathione lyase A3; GTA3; GSTA3-3; MGC22232;
Gene ID 2940
mRNA Refseq NM_000847
Protein Refseq NP_000838
MIM 605449
UniProt ID Q16772

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GSTA3 Products

Required fields are marked with *

My Review for All GSTA3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon