Recombinant Human GSTA3 protein, GST-tagged

• Cat.No.: GSTA3-242H
• Product Overview: Recombinant Human GSTA3 protein(NP_000838)(1-222 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-222 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• AA Sequence: MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGIKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRF
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).

Gene Information

• Gene Name: GSTA3 glutathione S-transferase alpha 3 [ Homo sapiens ]
• Official Symbol: GSTA3
• Synonyms: GSTA3; glutathione S-transferase alpha 3; glutathione S transferase A3; glutathione S-transferase A3; GST class-alpha member 3; glutathione S-transferase A3-3; glutathione S-aryltransferase A3; glutathione S-alkyltransferase A3; glutathione S-aralkyltransferase A3; S-(hydroxyalkyl)glutathione lyase A3; GTA3; GSTA3-3; MGC22232
• Gene ID: 2940
• mRNA Refseq: NM_000847
• Protein Refseq: NP_000838
• MIM: 605449
• UniProt ID: Q16772