Recombinant Human GSTA3 protein, GST-tagged
| Cat.No. : | GSTA3-242H |
| Product Overview : | Recombinant Human GSTA3 protein(NP_000838)(1-222 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-222 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGIKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRF |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). |
| Gene Name | GSTA3 glutathione S-transferase alpha 3 [ Homo sapiens ] |
| Official Symbol | GSTA3 |
| Synonyms | GSTA3; glutathione S-transferase alpha 3; glutathione S transferase A3; glutathione S-transferase A3; GST class-alpha member 3; glutathione S-transferase A3-3; glutathione S-aryltransferase A3; glutathione S-alkyltransferase A3; glutathione S-aralkyltransferase A3; S-(hydroxyalkyl)glutathione lyase A3; GTA3; GSTA3-3; MGC22232; |
| Gene ID | 2940 |
| mRNA Refseq | NM_000847 |
| Protein Refseq | NP_000838 |
| MIM | 605449 |
| UniProt ID | Q16772 |
| ◆ Recombinant Proteins | ||
| GSTA3-528H | Recombinant Human GSTA3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| GSTA3-7326M | Recombinant Mouse GSTA3 Protein | +Inquiry |
| GSTA3-2552H | Recombinant Human GSTA3 Protein (Met1-Phe222), N-His tagged | +Inquiry |
| GSTA3-2472H | Recombinant Human Glutathione S-transferase Alpha 3 | +Inquiry |
| GSTA3-13571H | Recombinant Human GSTA3 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GSTA3-758HCL | Recombinant Human GSTA3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSTA3 Products
Required fields are marked with *
My Review for All GSTA3 Products
Required fields are marked with *



