Recombinant Human GSTA3 protein, GST-tagged
Cat.No. : | GSTA3-242H |
Product Overview : | Recombinant Human GSTA3 protein(NP_000838)(1-222 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-222 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGIKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRF |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). |
Gene Name | GSTA3 glutathione S-transferase alpha 3 [ Homo sapiens ] |
Official Symbol | GSTA3 |
Synonyms | GSTA3; glutathione S-transferase alpha 3; glutathione S transferase A3; glutathione S-transferase A3; GST class-alpha member 3; glutathione S-transferase A3-3; glutathione S-aryltransferase A3; glutathione S-alkyltransferase A3; glutathione S-aralkyltransferase A3; S-(hydroxyalkyl)glutathione lyase A3; GTA3; GSTA3-3; MGC22232; |
Gene ID | 2940 |
mRNA Refseq | NM_000847 |
Protein Refseq | NP_000838 |
MIM | 605449 |
UniProt ID | Q16772 |
◆ Recombinant Proteins | ||
GSTA3-1809R | Recombinant Rhesus Macaque GSTA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
GSTA3-754C | Recombinant Chicken GSTA3 protein, His & T7-tagged | +Inquiry |
Gsta3-756R | Recombinant Rat Gsta3 protein, His-tagged | +Inquiry |
GSTA3-3968M | Recombinant Mouse GSTA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
GSTA3-212HF | Recombinant Full Length Human GSTA3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSTA3-758HCL | Recombinant Human GSTA3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSTA3 Products
Required fields are marked with *
My Review for All GSTA3 Products
Required fields are marked with *