Recombinant Human GSTA3 protein, His-tagged
| Cat.No. : | GSTA3-13571H |
| Product Overview : | Recombinant Human GSTA3 protein(1-222 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | November 30, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-222 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGIKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRF |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | GSTA3 glutathione S-transferase alpha 3 [ Homo sapiens ] |
| Official Symbol | GSTA3 |
| Synonyms | GSTA3; glutathione S-transferase alpha 3; glutathione S transferase A3; glutathione S-transferase A3; GST class-alpha member 3; glutathione S-transferase A3-3; glutathione S-aryltransferase A3; glutathione S-alkyltransferase A3; glutathione S-aralkyltransferase A3; S-(hydroxyalkyl)glutathione lyase A3; GTA3; GSTA3-3; MGC22232; |
| Gene ID | 2940 |
| mRNA Refseq | NM_000847 |
| Protein Refseq | NP_000838 |
| MIM | 605449 |
| UniProt ID | Q16772 |
| ◆ Recombinant Proteins | ||
| GSTA3-212HF | Recombinant Full Length Human GSTA3 Protein | +Inquiry |
| GSTA3-13571H | Recombinant Human GSTA3 protein, His-tagged | +Inquiry |
| GSTA3-754C | Recombinant Chicken GSTA3 protein, His & T7-tagged | +Inquiry |
| GSTA3-571C | Recombinant Cynomolgus GSTA3 Protein, His-tagged | +Inquiry |
| GSTA3-242H | Recombinant Human GSTA3 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GSTA3-758HCL | Recombinant Human GSTA3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSTA3 Products
Required fields are marked with *
My Review for All GSTA3 Products
Required fields are marked with *
