Recombinant Human GSTA4, GST-tagged

Cat.No. : GSTA4-27771TH
Product Overview : Recombinant full length Human GSTA4 with N terminal proprietary tag. Predicted MW 50.16 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 222 amino acids
Description : Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, which are located in a cluster on chromosome 6, are highly related and encode enzymes with glutathione peroxidase activity that function in the detoxification of lipid peroxidation products. Reactive electrophiles produced by oxidative metabolism have been linked to a number of degenerative diseases including Parkinsons disease, Alzheimers disease, cataract formation, and atherosclerosis.
Conjugation : GST
Molecular Weight : 50.160kDa inclusive of tags
Tissue specificity : Expressed at a high level in brain, placenta, and skeletal muscle and much lower in lung and liver.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQ LYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHN LFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKE VVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVIL LQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEP GSKKKPPPDEIYVRTVYNIFRP
Sequence Similarities : Belongs to the GST superfamily. Alpha family.Contains 1 GST C-terminal domain.Contains 1 GST N-terminal domain.
Gene Name GSTA4 glutathione S-transferase alpha 4 [ Homo sapiens ]
Official Symbol GSTA4
Synonyms GSTA4; glutathione S-transferase alpha 4; glutathione S transferase A4; glutathione S-transferase A4;
Gene ID 2941
mRNA Refseq NM_001512
Protein Refseq NP_001503
MIM 605450
Uniprot ID O15217
Chromosome Location 6p12.2
Pathway Biological oxidations, organism-specific biosystem; Drug metabolism - cytochrome P450, organism-specific biosystem; Drug metabolism - cytochrome P450, conserved biosystem; Glutathione conjugation, organism-specific biosystem; Glutathione metabolism, organism-specific biosystem;
Function glutathione transferase activity; glutathione transferase activity; glutathione transferase activity; protein homodimerization activity; transferase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GSTA4 Products

Required fields are marked with *

My Review for All GSTA4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon