Recombinant Human GSTA4 protein, GST-tagged

Cat.No. : GSTA4-277H
Product Overview : Recombinant Human GSTA4 protein(NP_001503)(1-222 aa), fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-222 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles.
Concentration : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name GSTA4 glutathione S-transferase alpha 4 [ Homo sapiens ]
Official Symbol GSTA4
Synonyms GSTA4; glutathione S-transferase alpha 4; glutathione S transferase A4; glutathione S-transferase A4; GST class-alpha member 4; glutathione transferase A4-4; glutathione S-transferase A4-4; glutathione S-aryltransferase A4; glutathione S-alkyltransferase A4; glutathione S-aralkyltransferase A4; S-(hydroxyalkyl)glutathione lyase A4; GTA4; GSTA4-4; DKFZp686D21185;
Gene ID 2941
mRNA Refseq NM_001512
Protein Refseq NP_001503
MIM 605450
UniProt ID O15217

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GSTA4 Products

Required fields are marked with *

My Review for All GSTA4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon