Recombinant Human GSTA4 protein, GST-tagged

• Cat.No.: GSTA4-277H
• Product Overview: Recombinant Human GSTA4 protein(NP_001503)(1-222 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-222 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles.
• Concentration: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: GSTA4 glutathione S-transferase alpha 4 [ Homo sapiens ]
• Official Symbol: GSTA4
• Synonyms: GSTA4; glutathione S-transferase alpha 4; glutathione S transferase A4; glutathione S-transferase A4; GST class-alpha member 4; glutathione transferase A4-4; glutathione S-transferase A4-4; glutathione S-aryltransferase A4; glutathione S-alkyltransferase A4; glutathione S-aralkyltransferase A4; S-(hydroxyalkyl)glutathione lyase A4; GTA4; GSTA4-4; DKFZp686D21185
• Gene ID: 2941
• mRNA Refseq: NM_001512
• Protein Refseq: NP_001503
• MIM: 605450
• UniProt ID: O15217