Recombinant Human GSTA4 protein, His-SUMO-tagged
| Cat.No. : | GSTA4-2998H |
| Product Overview : | Recombinant Human GSTA4 protein(O15217)(1-222aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-222aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 41.7 kDa |
| AA Sequence : | MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | GSTA4 glutathione S-transferase alpha 4 [ Homo sapiens ] |
| Official Symbol | GSTA4 |
| Synonyms | GSTA4; glutathione S-transferase alpha 4; glutathione S transferase A4; glutathione S-transferase A4; GST class-alpha member 4; glutathione transferase A4-4; glutathione S-transferase A4-4; glutathione S-aryltransferase A4; glutathione S-alkyltransferase A4; glutathione S-aralkyltransferase A4; S-(hydroxyalkyl)glutathione lyase A4; GTA4; GSTA4-4; DKFZp686D21185; |
| Gene ID | 2941 |
| mRNA Refseq | NM_001512 |
| Protein Refseq | NP_001503 |
| MIM | 605450 |
| UniProt ID | O15217 |
| ◆ Recombinant Proteins | ||
| GSTA4-3969M | Recombinant Mouse GSTA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GSTA4-15844H | Recombinant Human GSTA4, His-tagged | +Inquiry |
| GSTA4-24H | Active Recombinant Human GSTA4 protein, His-tagged | +Inquiry |
| GSTA4-7327M | Recombinant Mouse GSTA4 Protein | +Inquiry |
| GSTA4-1030H | Recombinant Human GSTA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GSTA4-5717HCL | Recombinant Human GSTA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSTA4 Products
Required fields are marked with *
My Review for All GSTA4 Products
Required fields are marked with *
