Recombinant Human GSTA4 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | GSTA4-3452H |
Product Overview : | GSTA4 MS Standard C13 and N15-labeled recombinant protein (NP_001503) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, which are located in a cluster on chromosome 6, are highly related and encode enzymes with glutathione peroxidase activity that function in the detoxification of lipid peroxidation products. Reactive electrophiles produced by oxidative metabolism have been linked to a number of degenerative diseases including Parkinson's disease, Alzheimer's disease, cataract formation, and atherosclerosis. |
Molecular Mass : | 25.7 kDa |
AA Sequence : | MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | GSTA4 glutathione S-transferase alpha 4 [ Homo sapiens (human) ] |
Official Symbol | GSTA4 |
Synonyms | GSTA4; glutathione S-transferase alpha 4; glutathione S transferase A4; glutathione S-transferase A4; GST class-alpha member 4; glutathione transferase A4-4; glutathione S-transferase A4-4; glutathione S-aryltransferase A4; glutathione S-alkyltransferase A4; glutathione S-aralkyltransferase A4; S-(hydroxyalkyl)glutathione lyase A4; GTA4; GSTA4-4; DKFZp686D21185; |
Gene ID | 2941 |
mRNA Refseq | NM_001512 |
Protein Refseq | NP_001503 |
MIM | 605450 |
UniProt ID | O15217 |
◆ Recombinant Proteins | ||
GSTA4-3969M | Recombinant Mouse GSTA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
GSTA4-318C | Recombinant Cynomolgus Monkey GSTA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
GSTA4-1956H | Recombinant Human Glutathione S-transferase Alpha 4, His-tagged | +Inquiry |
GSTA4-277H | Recombinant Human GSTA4 protein, GST-tagged | +Inquiry |
GSTA4-906H | Recombinant Human GSTA4 Protein, DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSTA4-5717HCL | Recombinant Human GSTA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSTA4 Products
Required fields are marked with *
My Review for All GSTA4 Products
Required fields are marked with *
0
Inquiry Basket