Recombinant Human GSTM3 protein, GST-tagged

Cat.No. : GSTM3-301608H
Product Overview : Recombinant Human GSTM3 (1-225 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met1-Cys225
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name GSTM3 glutathione S-transferase mu 3 (brain) [ Homo sapiens ]
Official Symbol GSTM3
Synonyms GSTM3; glutathione S-transferase mu 3 (brain); glutathione S transferase M3 (brain); glutathione S-transferase Mu 3; GST5; hGSTM3-3; brain GST; GST class-mu 3; glutathione S-transferase, Mu-3; glutathione S-aryltransferase M3; glutathione S-alkyltransferase M3; glutathione S-aralkyltransferase M3; S-(hydroxyalkyl)glutathione lyase M3; glutathione S-transferase M3 (brain); brain type mu-glutathione S-transferase; GSTB; GTM3; GSTM3-3; MGC3310; MGC3704;
Gene ID 2947
mRNA Refseq NM_000849
Protein Refseq NP_000840
MIM 138390
UniProt ID P21266

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAB39 Products

Required fields are marked with *

My Review for All RAB39 Products

Required fields are marked with *

0
cart-icon