Recombinant Human GSTM3 protein, GST-tagged

• Cat.No.: GSTM3-301608H
• Product Overview: Recombinant Human GSTM3 (1-225 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Cys225
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: GSTM3 glutathione S-transferase mu 3 (brain) [ Homo sapiens ]
• Official Symbol: GSTM3
• Synonyms: GSTM3; glutathione S-transferase mu 3 (brain); glutathione S transferase M3 (brain); glutathione S-transferase Mu 3; GST5; hGSTM3-3; brain GST; GST class-mu 3; glutathione S-transferase, Mu-3; glutathione S-aryltransferase M3; glutathione S-alkyltransferase M3; glutathione S-aralkyltransferase M3; S-(hydroxyalkyl)glutathione lyase M3; glutathione S-transferase M3 (brain); brain type mu-glutathione S-transferase; GSTB; GTM3; GSTM3-3; MGC3310; MGC3704
• Gene ID: 2947
• mRNA Refseq: NM_000849
• Protein Refseq: NP_000840
• MIM: 138390
• UniProt ID: P21266