Recombinant Human GSTO2 Protein, GST-tagged

Cat.No. : GSTO2-4426H
Product Overview : Human GSTO2 full-length ORF ( NP_899062.1, 1 a.a. - 243 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The omega class glutathione transferases (GST; EC 2.5.1.18) have poor activity with common GST substrates, but exhibit novel glutathione-dependent thioltransferase, dehydroascorbate reductase, and monomethylarsonate reductase activities, and they modulate Ca(2+) release by ryanodine receptors (e.g., RYR1, MIM 180901) (Whitbread et al., 2003 [PubMed 12618591]). For background information on GSTs, see MIM 605482.[supplied by OMIM
Molecular Mass : 54.7 kDa
AA Sequence : MSGDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYYTKHPFGHIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKVPHLTKECLVALRCGRECTNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDFGLC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GSTO2 glutathione S-transferase omega 2 [ Homo sapiens ]
Official Symbol GSTO2
Synonyms GSTO2; glutathione S-transferase omega 2; glutathione S-transferase omega-2; GSTO-2; MMA(V) reductase; monomethylarsonic acid reductase; glutathione S-transferase omega 2-2; glutathione-S-transferase-like protein; bA127L20.1 (novel glutathione-S-transferase); glutathione-dependent dehydroascorbate reductase; GSTO 2-2; bA127L20.1;
Gene ID 119391
mRNA Refseq NM_001191013
Protein Refseq NP_001177942
MIM 612314
UniProt ID Q9H4Y5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GSTO2 Products

Required fields are marked with *

My Review for All GSTO2 Products

Required fields are marked with *

0
cart-icon
0
compare icon