Recombinant Human GSTP1 Protein (2-210 aa), His-tagged

Cat.No. : GSTP1-2550H
Product Overview : Recombinant Human GSTP1 Protein (2-210 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 2-210 aa
Description : Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 25.2 kDa
AA Sequence : PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name GSTP1 glutathione S-transferase pi 1 [ Homo sapiens ]
Official Symbol GSTP1
Synonyms GSTP1; FAEES3, GST3; glutathione S-transferase P; GSTP; GSTP1-1; GST class-pi; PI; DFN7; GST3; FAEES3;
Gene ID 2950
mRNA Refseq NM_000852
Protein Refseq NP_000843
MIM 134660
UniProt ID P09211

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GSTP1 Products

Required fields are marked with *

My Review for All GSTP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon