Recombinant Human GSTP1 Protein (2-210 aa), His-tagged
| Cat.No. : | GSTP1-2550H |
| Product Overview : | Recombinant Human GSTP1 Protein (2-210 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 2-210 aa |
| Description : | Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 25.2 kDa |
| AA Sequence : | PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | GSTP1 glutathione S-transferase pi 1 [ Homo sapiens ] |
| Official Symbol | GSTP1 |
| Synonyms | GSTP1; FAEES3, GST3; glutathione S-transferase P; GSTP; GSTP1-1; GST class-pi; PI; DFN7; GST3; FAEES3; |
| Gene ID | 2950 |
| mRNA Refseq | NM_000852 |
| Protein Refseq | NP_000843 |
| MIM | 134660 |
| UniProt ID | P09211 |
| ◆ Recombinant Proteins | ||
| GSTP1-326C | Recombinant Cynomolgus Monkey GSTP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GSTP1-3999H | Recombinant Human GSTP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Gstp1-2222H | Recombinant Hamster Gstp1 Protein, His-tagged | +Inquiry |
| GSTP1-13581H | Recombinant Human GSTP1, His-tagged | +Inquiry |
| GSTP1-1086H | Active Recombinant Human GSTP1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GSTP1-191HKCL | Human GSTP1 Knockdown Cell Lysate | +Inquiry |
| GSTP1-5709HCL | Recombinant Human GSTP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSTP1 Products
Required fields are marked with *
My Review for All GSTP1 Products
Required fields are marked with *
