Recombinant Human GSX1 Protein, GST-tagged
Cat.No. : | GSX1-4434H |
Product Overview : | Human GSX1 full-length ORF ( AAI60140.1, 1 a.a. - 264 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | GSX1 (GS Homeobox 1) is a Protein Coding gene. GO annotations related to this gene include sequence-specific DNA binding and transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding. An important paralog of this gene is GSX2. |
Molecular Mass : | 29.1 kDa |
AA Sequence : | MPRSFLVDSLVLREAGEKKAPEGSPPPLFPYAVPPPHALHGLSPGACHARKAGLLCVCPLCVTASQLHGPPGPPALPLLKASFPPFGSQYCHAPLGRQHSAVSPGVAHGPAAAAAAAALYQTSYPLPDPRQFHCISVDSSSNQLPSSKRMRTAFTSTQLLELEREFASNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKGSNHRGGGGGGAGGGGSAPQGCKCASLSSAKCSEDDDELPMSPSSSGKDDRDLTVTP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GSX1 GS homeobox 1 [ Homo sapiens (human) ] |
Official Symbol | GSX1 |
Synonyms | GS Homeobox 1; GSH1; Genomic Screened Homeo Box 1; GS Homeo Box Protein 1; Homeobox Protein Gsh-1; Homeobox Protein GSH-1; Gsh-1; GSX1; GS homeobox 1; GS homeo box protein 1; genomic screened homeo box 1; homeobox protein Gsh-1 |
Gene ID | 219409 |
mRNA Refseq | NM_145657 |
Protein Refseq | NM_145657 |
MIM | 616542 |
UniProt ID | Q9H4S2 |
◆ Recombinant Proteins | ||
GSX1-4434H | Recombinant Human GSX1 Protein, GST-tagged | +Inquiry |
GSX1-2007Z | Recombinant Zebrafish GSX1 | +Inquiry |
GSX1-3371HF | Recombinant Full Length Human GSX1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSX1 Products
Required fields are marked with *
My Review for All GSX1 Products
Required fields are marked with *