Recombinant Human GSX2 Protein, GST-tagged
Cat.No. : | GSX2-4396H |
Product Overview : | Human GSH2 partial ORF ( NP_573574, 1 a.a. - 70 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | GSX2 (GS Homeobox 2) is a Protein Coding gene. GO annotations related to this gene include sequence-specific DNA binding. An important paralog of this gene is GSX1. |
Molecular Mass : | 33.44 kDa |
AA Sequence : | MSRSFYVDSLIIKDTSRPAPSLPEPHPGPDFFIPLGMPPPLVMSVSGPGCPSRKSGAFCVCPLCVTSHLH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GSX2 GS homeobox 2 [ Homo sapiens ] |
Official Symbol | GSX2 |
Synonyms | GSX2; GS homeobox 2; Gsh2; homeobox protein GSH-2; GSH2; |
Gene ID | 170825 |
mRNA Refseq | NM_133267 |
Protein Refseq | NP_573574 |
UniProt ID | Q9BZM3 |
◆ Recombinant Proteins | ||
GSX2-7347M | Recombinant Mouse GSX2 Protein | +Inquiry |
GSX2-3131Z | Recombinant Zebrafish GSX2 | +Inquiry |
GSX2-4396H | Recombinant Human GSX2 Protein, GST-tagged | +Inquiry |
GSX2-3984M | Recombinant Mouse GSX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSX2 Products
Required fields are marked with *
My Review for All GSX2 Products
Required fields are marked with *