Recombinant Human GSX2 Protein, GST-tagged

Cat.No. : GSX2-4396H
Product Overview : Human GSH2 partial ORF ( NP_573574, 1 a.a. - 70 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : GSX2 (GS Homeobox 2) is a Protein Coding gene. GO annotations related to this gene include sequence-specific DNA binding. An important paralog of this gene is GSX1.
Molecular Mass : 33.44 kDa
AA Sequence : MSRSFYVDSLIIKDTSRPAPSLPEPHPGPDFFIPLGMPPPLVMSVSGPGCPSRKSGAFCVCPLCVTSHLH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GSX2 GS homeobox 2 [ Homo sapiens ]
Official Symbol GSX2
Synonyms GSX2; GS homeobox 2; Gsh2; homeobox protein GSH-2; GSH2;
Gene ID 170825
mRNA Refseq NM_133267
Protein Refseq NP_573574
UniProt ID Q9BZM3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GSX2 Products

Required fields are marked with *

My Review for All GSX2 Products

Required fields are marked with *

0
cart-icon