Recombinant Human GTF2A1 Protein, GST-tagged
Cat.No. : | GTF2A1-4437H |
Product Overview : | Human GTF2A1 full-length ORF ( NP_056943.1, 1 a.a. - 376 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Accurate transcription initiation on TATA-containing class II genes involves the ordered assembly of RNA polymerase II (POLR2A; MIM 180660) and several general initiation factors (summarized by DeJong and Roeder, 1993 [PubMed 8224848]). One of these factors is TFIIA, which when purified from HeLa extracts consists of 35-, 19-, and 12-kD subunits.[supplied by OMIM, Jul 2010] |
Molecular Mass : | 67.9 kDa |
AA Sequence : | MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQQLLLQVQQQHQPQQQQHHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTVAAPTPAQAQITATGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GTF2A1 general transcription factor IIA, 1, 19/37kDa [ Homo sapiens ] |
Official Symbol | GTF2A1 |
Synonyms | GTF2A1; general transcription factor IIA, 1, 19/37kDa; glucose regulated protein, 58kD pseudogene; transcription initiation factor IIA subunit 1; TFIIA; TFIIAL; TFIIA-42; TFIIA alpha, p55, isoform 1; general transcription factor IIA subunit 1; transcription initiation factor TFIIA 42 kDa subunit; TF2A1; MGC129969; MGC129970; |
Gene ID | 2957 |
mRNA Refseq | NM_015859 |
Protein Refseq | NP_056943 |
MIM | 600520 |
UniProt ID | P52655 |
◆ Recombinant Proteins | ||
GTF2A1-11933Z | Recombinant Zebrafish GTF2A1 | +Inquiry |
GTF2A1-2870C | Recombinant Chicken GTF2A1 | +Inquiry |
GTF2A1-3373HF | Recombinant Full Length Human GTF2A1 Protein, GST-tagged | +Inquiry |
GTF2A1-2739R | Recombinant Rat GTF2A1 Protein | +Inquiry |
GTF2A1-4437H | Recombinant Human GTF2A1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GTF2A1-762HCL | Recombinant Human GTF2A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GTF2A1 Products
Required fields are marked with *
My Review for All GTF2A1 Products
Required fields are marked with *