"GTF2A1" Related Products

Expand
Expand
Expand

Recombinant Human GTF2A1 Protein, GST-tagged

Cat.No.: GTF2A1-4437H
Product Overview: Human GTF2A1 full-length ORF ( NP_056943.1, 1 a.a. - 376 a.a.) recombinant protein with GST-tag at N-terminal.
Description: Accurate transcription initiation on TATA-containing class II genes involves the ordered assembly of RNA polymerase II (POLR2A; MIM 180660) and several general initiation factors (summarized by DeJong and Roeder, 1993 [PubMed 8224848]). One of these factors is TFIIA, which when purified from HeLa extracts consists of 35-, 19-, and 12-kD subunits.[supplied by OMIM, Jul 2010]
Source: Wheat Germ
Species: Human
Tag : GST
Molecular Mass: 67.9 kDa
AA Sequence: MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQQLLLQVQQQHQPQQQQHHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTVAAPTPAQAQITATGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW
Applications: Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: GTF2A1 general transcription factor IIA, 1, 19/37kDa [ Homo sapiens ]
Official Symbol: GTF2A1
Synonyms: GTF2A1; general transcription factor IIA, 1, 19/37kDa; glucose regulated protein, 58kD pseudogene; transcription initiation factor IIA subunit 1; TFIIA; TFIIAL; TFIIA-42; TFIIA alpha, p55, isoform 1; general transcription factor IIA subunit 1; transcription initiation factor TFIIA 42 kDa subunit; TF2A1; MGC129969; MGC129970;
Gene ID: 2957
mRNA Refseq: NM_015859
Protein Refseq: NP_056943
MIM: 600520
UniProt ID: P52655

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.