Recombinant Human GTF2A1 Protein, GST-tagged
| Cat.No. : | GTF2A1-4437H | 
| Product Overview : | Human GTF2A1 full-length ORF ( NP_056943.1, 1 a.a. - 376 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | Accurate transcription initiation on TATA-containing class II genes involves the ordered assembly of RNA polymerase II (POLR2A; MIM 180660) and several general initiation factors (summarized by DeJong and Roeder, 1993 [PubMed 8224848]). One of these factors is TFIIA, which when purified from HeLa extracts consists of 35-, 19-, and 12-kD subunits.[supplied by OMIM, Jul 2010] | 
| Molecular Mass : | 67.9 kDa | 
| AA Sequence : | MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQQLLLQVQQQHQPQQQQHHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTVAAPTPAQAQITATGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array  | 
                                
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | GTF2A1 general transcription factor IIA, 1, 19/37kDa [ Homo sapiens ] | 
| Official Symbol | GTF2A1 | 
| Synonyms | GTF2A1; general transcription factor IIA, 1, 19/37kDa; glucose regulated protein, 58kD pseudogene; transcription initiation factor IIA subunit 1; TFIIA; TFIIAL; TFIIA-42; TFIIA alpha, p55, isoform 1; general transcription factor IIA subunit 1; transcription initiation factor TFIIA 42 kDa subunit; TF2A1; MGC129969; MGC129970; | 
| Gene ID | 2957 | 
| mRNA Refseq | NM_015859 | 
| Protein Refseq | NP_056943 | 
| MIM | 600520 | 
| UniProt ID | P52655 | 
| ◆ Recombinant Proteins | ||
| GTF2A1-2870C | Recombinant Chicken GTF2A1 | +Inquiry | 
| GTF2A1-1821R | Recombinant Rhesus Macaque GTF2A1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| GTF2A1-1170H | Active Recombinant Human General Transcription Factor IIA, 1, 19/37kDa | +Inquiry | 
| GTF2A1-1171H | Active Recombinant Human GTF2A1, P12, GST-tagged | +Inquiry | 
| GTF2A1-27774TH | Recombinant Human GTF2A1 | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| GTF2A1-762HCL | Recombinant Human GTF2A1 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All GTF2A1 Products
Required fields are marked with *
My Review for All GTF2A1 Products
Required fields are marked with *
  
        
    
      
            