Recombinant Human GTF3C2 protein, His-tagged
Cat.No. : | GTF3C2-2767H |
Product Overview : | Recombinant Human GTF3C2 protein(59-188 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | August 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 59-188 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | GFEDSPDQRRLPPEQESLSRLEQPDLSSEMSKVSKPRASKPGRKRGGRTRKGPKRPQQPNPPSAPLVPGLLDQSNPLSTPMPKKRGRKSKAELLLLKLSKDLDRPESQSPKRPPEDFETPSGERPRRRAA |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | GTF3C2 general transcription factor IIIC, polypeptide 2, beta 110kDa [ Homo sapiens ] |
Official Symbol | GTF3C2 |
Synonyms | GTF3C2; general transcription factor IIIC, polypeptide 2, beta 110kDa; general transcription factor IIIC, polypeptide 2 (beta subunit, 110kD); general transcription factor 3C polypeptide 2; KIAA0011; TFIIIC110; TF3C-beta; TFIIIC 110 kDa subunit; transcription factor IIIC subunit beta; transcription factor IIIC 110 kDa subunit; TFIIIC-BETA; |
mRNA Refseq | NM_001035521 |
Protein Refseq | NP_001030598 |
MIM | 604883 |
UniProt ID | Q8WUA4 |
Gene ID | 2976 |
◆ Recombinant Proteins | ||
GTF3C2-4462H | Recombinant Human GTF3C2 Protein, GST-tagged | +Inquiry |
GTF3C2-7854H | Recombinant Human GTF3C2 protein, GST-tagged | +Inquiry |
GTF3C2-3414HF | Recombinant Full Length Human GTF3C2 Protein, GST-tagged | +Inquiry |
GTF3C2-3997M | Recombinant Mouse GTF3C2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GTF3C2-3985H | Recombinant Human GTF3C2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
GTF3C2-5690HCL | Recombinant Human GTF3C2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GTF3C2 Products
Required fields are marked with *
My Review for All GTF3C2 Products
Required fields are marked with *