Recombinant Human GTF3C2 protein, His-tagged
| Cat.No. : | GTF3C2-2767H |
| Product Overview : | Recombinant Human GTF3C2 protein(59-188 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | December 19, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | His |
| Protein Length : | 59-188 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | GFEDSPDQRRLPPEQESLSRLEQPDLSSEMSKVSKPRASKPGRKRGGRTRKGPKRPQQPNPPSAPLVPGLLDQSNPLSTPMPKKRGRKSKAELLLLKLSKDLDRPESQSPKRPPEDFETPSGERPRRRAA |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | GTF3C2 general transcription factor IIIC, polypeptide 2, beta 110kDa [ Homo sapiens ] |
| Official Symbol | GTF3C2 |
| Synonyms | GTF3C2; general transcription factor IIIC, polypeptide 2, beta 110kDa; general transcription factor IIIC, polypeptide 2 (beta subunit, 110kD); general transcription factor 3C polypeptide 2; KIAA0011; TFIIIC110; TF3C-beta; TFIIIC 110 kDa subunit; transcription factor IIIC subunit beta; transcription factor IIIC 110 kDa subunit; TFIIIC-BETA; |
| mRNA Refseq | NM_001035521 |
| Protein Refseq | NP_001030598 |
| MIM | 604883 |
| UniProt ID | Q8WUA4 |
| Gene ID | 2976 |
| ◆ Recombinant Proteins | ||
| GTF3C2-3985H | Recombinant Human GTF3C2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| GTF3C2-3414HF | Recombinant Full Length Human GTF3C2 Protein, GST-tagged | +Inquiry |
| GTF3C2-7367M | Recombinant Mouse GTF3C2 Protein | +Inquiry |
| GTF3C2-4462H | Recombinant Human GTF3C2 Protein, GST-tagged | +Inquiry |
| GTF3C2-2767H | Recombinant Human GTF3C2 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GTF3C2-5690HCL | Recombinant Human GTF3C2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GTF3C2 Products
Required fields are marked with *
My Review for All GTF3C2 Products
Required fields are marked with *
