Recombinant Human GTPBP10 Protein, GST-tagged

Cat.No. : GTPBP10-4470H
Product Overview : Human GTPBP10 full-length ORF (BAC04573.1, 1 a.a. - 387 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Small G proteins, such as GTPBP10, act as molecular switches that play crucial roles in the regulation of fundamental cellular processes such as protein synthesis, nuclear transport, membrane trafficking, and signal transduction (Hirano et al., 2006 [PubMed 17054726]).[supplied by OMIM
Molecular Mass : 69.4 kDa
AA Sequence : MVHCSCVLFRKYGNFIDKLRLFTRGGSGGMGYPRLGGEGGKGGDVWVVAQNRMTLKQLKDRYPRKRFVAGVGANSKISALKGSKGKDWEIPVPVGISVTDENGKIIGELNKENDRILVAQGGLGGKLLTNFLPLKGQKRIIHLDLKLIADVGLVGFPNAGKSSLLSCVSHAKPAIADYAFTTLKPELGKIMYSDFKQISVADLPGLIEGAHMNKGMGHKFLKHIERTRQLLFVVDISGFQLSSHTQYRTAFETIILLTKELELYKEELQTKPALLAVNKMDLPDAQDKFHELMSQLQNPKDFLHLFEKNMIPERTVEFQHIIPISAVTGEGIEELKNCIRKSLDEQANQENDALHKKQLLNLWISDTMSSTEPPSKHAVTTSKMDII
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GTPBP10 GTP-binding protein 10 (putative) [ Homo sapiens ]
Official Symbol GTPBP10
Synonyms GTPBP10; GTP-binding protein 10 (putative); GTP-binding protein 10; DKFZP686A10121; FLJ38242; protein obg homolog 2; ObgH2; UG0751c10; MGC104191; DKFZp686A10121;
Gene ID 85865
mRNA Refseq NM_001042717
Protein Refseq NP_001036182
MIM 610920
UniProt ID A4D1E9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GTPBP10 Products

Required fields are marked with *

My Review for All GTPBP10 Products

Required fields are marked with *

0
cart-icon
0
compare icon