Recombinant Human GTPBP10 Protein, GST-tagged
Cat.No. : | GTPBP10-4470H |
Product Overview : | Human GTPBP10 full-length ORF (BAC04573.1, 1 a.a. - 387 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Small G proteins, such as GTPBP10, act as molecular switches that play crucial roles in the regulation of fundamental cellular processes such as protein synthesis, nuclear transport, membrane trafficking, and signal transduction (Hirano et al., 2006 [PubMed 17054726]).[supplied by OMIM |
Molecular Mass : | 69.4 kDa |
AA Sequence : | MVHCSCVLFRKYGNFIDKLRLFTRGGSGGMGYPRLGGEGGKGGDVWVVAQNRMTLKQLKDRYPRKRFVAGVGANSKISALKGSKGKDWEIPVPVGISVTDENGKIIGELNKENDRILVAQGGLGGKLLTNFLPLKGQKRIIHLDLKLIADVGLVGFPNAGKSSLLSCVSHAKPAIADYAFTTLKPELGKIMYSDFKQISVADLPGLIEGAHMNKGMGHKFLKHIERTRQLLFVVDISGFQLSSHTQYRTAFETIILLTKELELYKEELQTKPALLAVNKMDLPDAQDKFHELMSQLQNPKDFLHLFEKNMIPERTVEFQHIIPISAVTGEGIEELKNCIRKSLDEQANQENDALHKKQLLNLWISDTMSSTEPPSKHAVTTSKMDII |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GTPBP10 GTP-binding protein 10 (putative) [ Homo sapiens ] |
Official Symbol | GTPBP10 |
Synonyms | GTPBP10; GTP-binding protein 10 (putative); GTP-binding protein 10; DKFZP686A10121; FLJ38242; protein obg homolog 2; ObgH2; UG0751c10; MGC104191; DKFZp686A10121; |
Gene ID | 85865 |
mRNA Refseq | NM_001042717 |
Protein Refseq | NP_001036182 |
MIM | 610920 |
UniProt ID | A4D1E9 |
◆ Recombinant Proteins | ||
GTPBP10-4000M | Recombinant Mouse GTPBP10 Protein, His (Fc)-Avi-tagged | +Inquiry |
GTPBP10-7373M | Recombinant Mouse GTPBP10 Protein | +Inquiry |
Gtpbp10-3332M | Recombinant Mouse Gtpbp10 Protein, Myc/DDK-tagged | +Inquiry |
GTPBP10-4470H | Recombinant Human GTPBP10 Protein, GST-tagged | +Inquiry |
GTPBP10-3422HF | Recombinant Full Length Human GTPBP10 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GTPBP10-5686HCL | Recombinant Human GTPBP10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GTPBP10 Products
Required fields are marked with *
My Review for All GTPBP10 Products
Required fields are marked with *
0
Inquiry Basket