Recombinant Human GTSF1L protein, His-tagged
| Cat.No. : | GTSF1L-13614H |
| Product Overview : | Recombinant Human GTSF1L protein(1-148 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | January 30, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-148 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | MEPEAFEICPYDPHHRIPLSRFQYHLASCRRKNPKKAKKMATCKYNACHVVPIKNLEEHEAVCVNRSAVEEEDTENPLKVSPPSSEQNDDTQQVSPCLPSPDIWNVDGANCQHVFVLKTFFPQKVVCENDTKESARETSPQKILRPGQ |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| MIM-Weblink : |
| Gene Name | GTSF1L gametocyte specific factor 1-like [ Homo sapiens ] |
| Official Symbol | GTSF1L |
| Synonyms | gametocyte specific factor 1-like; 16198; Ensembl:ENSG00000124196; MGC50820; gametocyte-specific factor 1-like;family with sequence similarity 112, member A; FAM112A; C20orf65; dJ1028D15.4 |
| Gene ID | 149699 |
| mRNA Refseq | NM_001008901.1 |
| Protein Refseq | NP_001008901.1 |
| UniProt ID | Q5JWH5 |
| ◆ Recombinant Proteins | ||
| Gtsf1l-3337M | Recombinant Mouse Gtsf1l Protein, Myc/DDK-tagged | +Inquiry |
| GTSF1L-983H | Recombinant Human GTSF1L Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| GTSF1L-13614H | Recombinant Human GTSF1L protein, His-tagged | +Inquiry |
| GTSF1L-2545H | Recombinant Human GTSF1L Protein, MYC/DDK-tagged | +Inquiry |
| GTSF1L-2544H | Recombinant Human GTSF1L Protein, DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GTSF1L Products
Required fields are marked with *
My Review for All GTSF1L Products
Required fields are marked with *
