Recombinant Human GUCA2B protein, His-SUMO-tagged
| Cat.No. : | GUCA2B-4375H |
| Product Overview : | Recombinant Human GUCA2B protein(Q16661)(27-112aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 27-112aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 25.5 kDa |
| AA Sequence : | VYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | GUCA2B guanylate cyclase activator 2B (uroguanylin) [ Homo sapiens ] |
| Official Symbol | GUCA2B |
| Synonyms | GUCA2B; guanylate cyclase activator 2B (uroguanylin); guanylate cyclase activator 2B; uroguanylin; UGN; GCAP-II; |
| Gene ID | 2981 |
| mRNA Refseq | NM_007102 |
| Protein Refseq | NP_009033 |
| MIM | 601271 |
| UniProt ID | Q16661 |
| ◆ Recombinant Proteins | ||
| GUCA2B-5392G | Recombinant Guinea pig GUCA2B protein | +Inquiry |
| GUCA2B-127H | Recombinant Human Guanylate Cyclase Activator 2B (Uroguanylin) | +Inquiry |
| Guca2b-1607R | Recombinant Rat Guca2b Protein, His-tagged | +Inquiry |
| GUCA2B-1407M | Recombinant Mouse GUCA2B Protein (22-106 aa), His-tagged | +Inquiry |
| GUCA2B-5394G | Recombinant Guinea pig GUCA2B protein, Avi-tagged, Biotinylated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GUCA2B-767HCL | Recombinant Human GUCA2B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GUCA2B Products
Required fields are marked with *
My Review for All GUCA2B Products
Required fields are marked with *
