Recombinant Human GUCA2B protein, His-SUMO-tagged

Cat.No. : GUCA2B-4375H
Product Overview : Recombinant Human GUCA2B protein(Q16661)(27-112aa), fused to N-terminal His-SUMO tag, was expressed in E. coli
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 27-112aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 25.5 kDa
AA Sequence : VYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name GUCA2B guanylate cyclase activator 2B (uroguanylin) [ Homo sapiens ]
Official Symbol GUCA2B
Synonyms GUCA2B; guanylate cyclase activator 2B (uroguanylin); guanylate cyclase activator 2B; uroguanylin; UGN; GCAP-II;
Gene ID 2981
mRNA Refseq NM_007102
Protein Refseq NP_009033
MIM 601271
UniProt ID Q16661

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GUCA2B Products

Required fields are marked with *

My Review for All GUCA2B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon