Recombinant Human GUCA2B protein, His-SUMO-tagged
| Cat.No. : | GUCA2B-4375H | 
| Product Overview : | Recombinant Human GUCA2B protein(Q16661)(27-112aa), fused to N-terminal His-SUMO tag, was expressed in E. coli | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His&SUMO | 
| Protein Length : | 27-112aa | 
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. | 
| Molecular Mass : | 25.5 kDa | 
| AA Sequence : | VYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. | 
| Gene Name | GUCA2B guanylate cyclase activator 2B (uroguanylin) [ Homo sapiens ] | 
| Official Symbol | GUCA2B | 
| Synonyms | GUCA2B; guanylate cyclase activator 2B (uroguanylin); guanylate cyclase activator 2B; uroguanylin; UGN; GCAP-II; | 
| Gene ID | 2981 | 
| mRNA Refseq | NM_007102 | 
| Protein Refseq | NP_009033 | 
| MIM | 601271 | 
| UniProt ID | Q16661 | 
| ◆ Recombinant Proteins | ||
| GUCA2B-2407R | Recombinant Rat GUCA2B Protein, His (Fc)-Avi-tagged | +Inquiry | 
| Guca2b-1606M | Recombinant Mouse Guca2b Protein, His-tagged | +Inquiry | 
| GUCA2B-5392G | Recombinant Guinea pig GUCA2B protein | +Inquiry | 
| GUCA2B-4375H | Recombinant Human GUCA2B protein, His-SUMO-tagged | +Inquiry | 
| GUCA2B-5396G | Recombinant Guinea pig GUCA2B protein | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| GUCA2B-767HCL | Recombinant Human GUCA2B cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GUCA2B Products
Required fields are marked with *
My Review for All GUCA2B Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            