Recombinant Human GUCA2B Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : GUCA2B-368H
Product Overview : GUCA2B MS Standard C13 and N15-labeled recombinant protein (NP_009033) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products, including uroguanylin, a member of the guanylin family of peptides and an endogenous ligand of the guanylate cyclase-C receptor. Binding of this peptide to its cognate receptor stimulates an increase in cyclic GMP and may regulate salt and water homeostasis in the intestine and kidneys. [provided by RefSeq, Nov 2015]
Molecular Mass : 12.1 kDa
AA Sequence : MGCRAASGLLPGVAVVLLLLLQSTQSVYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name GUCA2B guanylate cyclase activator 2B (uroguanylin) [ Homo sapiens (human) ]
Official Symbol GUCA2B
Synonyms GUCA2B; guanylate cyclase activator 2B (uroguanylin); guanylate cyclase activator 2B; uroguanylin; UGN; GCAP-II;
Gene ID 2981
mRNA Refseq NM_007102
Protein Refseq NP_009033
MIM 601271
UniProt ID Q16661

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GUCA2B Products

Required fields are marked with *

My Review for All GUCA2B Products

Required fields are marked with *

0
cart-icon
0
compare icon