Recombinant Human GUCY2C Protein, GST-tagged

Cat.No. : GUCY2C-4492H
Product Overview : Human GUCY2C partial ORF ( NP_004954, 24 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a transmembrane protein that functions as a receptor for endogenous peptides guanylin and uroguanylin, and the heat-stable E. coli enterotoxin. The encoded protein activates the cystic fibrosis transmembrane conductance regulator. Mutations in this gene are associated with familial diarrhea (autosomal dominant) and meconium ileus (autosomal recessive). [provided by RefSeq, Nov 2016]
Molecular Mass : 37.73 kDa
AA Sequence : SQVSQNCHNGSYEISVLMMGNSAFAEPLKNLEDAVNEGLEIVRGRLQNAGLNVTVNATFMYSDGLIHNSGDCRSSTCEGLDLLRKISNAQRMGCVLIGPSCTYSTFQMYL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GUCY2C guanylate cyclase 2C (heat stable enterotoxin receptor) [ Homo sapiens ]
Official Symbol GUCY2C
Synonyms GUCY2C; guanylate cyclase 2C (heat stable enterotoxin receptor); GUC2C; heat-stable enterotoxin receptor; STAR; GC-C; hSTAR; STA receptor; guanylyl cyclase C; intestinal guanylate cyclase;
Gene ID 2984
mRNA Refseq NM_004963
Protein Refseq NP_004954
MIM 601330
UniProt ID P25092

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GUCY2C Products

Required fields are marked with *

My Review for All GUCY2C Products

Required fields are marked with *

0
cart-icon