Recombinant Human GUCY2C Protein, GST-tagged
| Cat.No. : | GUCY2C-4492H |
| Product Overview : | Human GUCY2C partial ORF ( NP_004954, 24 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a transmembrane protein that functions as a receptor for endogenous peptides guanylin and uroguanylin, and the heat-stable E. coli enterotoxin. The encoded protein activates the cystic fibrosis transmembrane conductance regulator. Mutations in this gene are associated with familial diarrhea (autosomal dominant) and meconium ileus (autosomal recessive). [provided by RefSeq, Nov 2016] |
| Molecular Mass : | 37.73 kDa |
| AA Sequence : | SQVSQNCHNGSYEISVLMMGNSAFAEPLKNLEDAVNEGLEIVRGRLQNAGLNVTVNATFMYSDGLIHNSGDCRSSTCEGLDLLRKISNAQRMGCVLIGPSCTYSTFQMYL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GUCY2C guanylate cyclase 2C (heat stable enterotoxin receptor) [ Homo sapiens ] |
| Official Symbol | GUCY2C |
| Synonyms | GUCY2C; guanylate cyclase 2C (heat stable enterotoxin receptor); GUC2C; heat-stable enterotoxin receptor; STAR; GC-C; hSTAR; STA receptor; guanylyl cyclase C; intestinal guanylate cyclase; |
| Gene ID | 2984 |
| mRNA Refseq | NM_004963 |
| Protein Refseq | NP_004954 |
| MIM | 601330 |
| UniProt ID | P25092 |
| ◆ Recombinant Proteins | ||
| GUCY2C-3280C | Recombinant Cynomolgus monkey GUCY2C protein(24-430aa), His-tagged | +Inquiry |
| GUCY2C-1842M | Recombinant Mouse GUCY2C protein, His-tagged | +Inquiry |
| GUCY2C-4818G | Recombinant Guinea pig GUCY2C protein | +Inquiry |
| GUCY2C-1500C | Active Recombinant Cynomolgus GUCY2C protein, Fc-tagged | +Inquiry |
| GUCY2C-1498H | Active Recombinant Human GUCY2C protein, Fc-tagged, FITC-Labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GUCY2C-5675HCL | Recombinant Human GUCY2C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GUCY2C Products
Required fields are marked with *
My Review for All GUCY2C Products
Required fields are marked with *



