Recombinant Human GUCY2F protein, His-tagged

Cat.No. : GUCY2F-0406H
Product Overview : Recombinant Human GUCY2F protein(71-398 aa), fused to His tag, was expressed in E. coli.
Availability January 08, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 71-398 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : LPEVAARLAIERINRDPSFDLSYSFEYVILNEDCQTSRALSSFISHHQMASGFIGPTNPGYCEAASLLGNSWDKGIFSWACVNYELDNKISYPTFSRTLPSPIRVLVTVMKYFQWAHAGVISSDEDIWVHTANRVASALRSHGLPVGVVLTTGQDSQSMRKALQRIHQADRIRIIIMCMHSALIGGETQMHLLECAHDLKMTDGTYVFVPYDALLYSLPYKHTPYRVLRNNPKLREAYDAVLTITVESQEKTFYQAFTEAAARGEIPEKLEFDQVSPLFGTIYNSIYFIAQAMNNAMKENGQAGAASLVQHSRNMQFHGFNQLMRTDS
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name GUCY2F guanylate cyclase 2F, retinal [ Homo sapiens ]
Official Symbol GUCY2F
Synonyms GUCY2F; guanylate cyclase 2F, retinal; retinal guanylyl cyclase 2; CYGF; GC F; guanylate cyclase 2D like; membrane (retina specific); GUC2DL; RetGC 2; ROS GC2; guanylate cyclase F; rod outer segment membrane guanylate cyclase 2; guanylate cyclase 2D-like, membrane (retina-specific); GC-F; GUC2F; RETGC-2; ROS-GC2;
Gene ID 2986
mRNA Refseq NM_001522
Protein Refseq NP_001513
MIM 300041
UniProt ID P51841

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GUCY2F Products

Required fields are marked with *

My Review for All GUCY2F Products

Required fields are marked with *

0
cart-icon
0
compare icon