Recombinant Human GUCY2F protein, His-tagged
Cat.No. : | GUCY2F-0406H |
Product Overview : | Recombinant Human GUCY2F protein(71-398 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 71-398 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LPEVAARLAIERINRDPSFDLSYSFEYVILNEDCQTSRALSSFISHHQMASGFIGPTNPGYCEAASLLGNSWDKGIFSWACVNYELDNKISYPTFSRTLPSPIRVLVTVMKYFQWAHAGVISSDEDIWVHTANRVASALRSHGLPVGVVLTTGQDSQSMRKALQRIHQADRIRIIIMCMHSALIGGETQMHLLECAHDLKMTDGTYVFVPYDALLYSLPYKHTPYRVLRNNPKLREAYDAVLTITVESQEKTFYQAFTEAAARGEIPEKLEFDQVSPLFGTIYNSIYFIAQAMNNAMKENGQAGAASLVQHSRNMQFHGFNQLMRTDS |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | GUCY2F guanylate cyclase 2F, retinal [ Homo sapiens ] |
Official Symbol | GUCY2F |
Synonyms | GUCY2F; guanylate cyclase 2F, retinal; retinal guanylyl cyclase 2; CYGF; GC F; guanylate cyclase 2D like; membrane (retina specific); GUC2DL; RetGC 2; ROS GC2; guanylate cyclase F; rod outer segment membrane guanylate cyclase 2; guanylate cyclase 2D-like, membrane (retina-specific); GC-F; GUC2F; RETGC-2; ROS-GC2; |
Gene ID | 2986 |
mRNA Refseq | NM_001522 |
Protein Refseq | NP_001513 |
MIM | 300041 |
UniProt ID | P51841 |
◆ Recombinant Proteins | ||
GUCY2F-0406H | Recombinant Human GUCY2F protein, His-tagged | +Inquiry |
GUCY2F-9369Z | Recombinant Zebrafish GUCY2F | +Inquiry |
GUCY2F-2413R | Recombinant Rat GUCY2F Protein, His (Fc)-Avi-tagged | +Inquiry |
GUCY2F-2759R | Recombinant Rat GUCY2F Protein | +Inquiry |
GUCY2F-4494H | Recombinant Human GUCY2F Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GUCY2F Products
Required fields are marked with *
My Review for All GUCY2F Products
Required fields are marked with *
0
Inquiry Basket