Recombinant Human GYG1 Protein, GST-tagged
Cat.No. : | GYG1-4502H |
Product Overview : | Human GYG partial ORF ( NP_004121, 1 a.a. - 73 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the glycogenin family. Glycogenin is a glycosyltransferase that catalyzes the formation of a short glucose polymer from uridine diphosphate glucose in an autoglucosylation reaction. This reaction is followed by elongation and branching of the polymer, catalyzed by glycogen synthase and branching enzyme, to form glycogen. This gene is expressed in muscle and other tissues. Mutations in this gene result in glycogen storage disease XV. This gene has pseudogenes on chromosomes 1, 8 and 13 respectively. Alternatively spliced transcript variants encoding different isoforms have been identified.[provided by RefSeq, Sep 2010] |
Molecular Mass : | 33.77 kDa |
AA Sequence : | MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GYG1 glycogenin 1 [ Homo sapiens ] |
Official Symbol | GYG1 |
Synonyms | GYG1; glycogenin 1; glycogenin , GYG; glycogenin-1; GN-1; GYG; GSD15; |
Gene ID | 2992 |
mRNA Refseq | NM_001184720 |
Protein Refseq | NP_001171649 |
MIM | 603942 |
UniProt ID | P46976 |
◆ Recombinant Proteins | ||
GYG1-2419R | Recombinant Rat GYG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GYG1-186H | Recombinant Human Glycogenin 1, His-T7-tagged | +Inquiry |
GYG1-2765R | Recombinant Rat GYG1 Protein | +Inquiry |
GYG1-2867H | Recombinant Human GYG1 Protein (Met1-Asp331), N-GST tagged | +Inquiry |
GYG1-13627H | Recombinant Human GYG1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GYG1-5672HCL | Recombinant Human GYG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GYG1 Products
Required fields are marked with *
My Review for All GYG1 Products
Required fields are marked with *
0
Inquiry Basket