Recombinant Human GYG1 Protein, GST-tagged

Cat.No. : GYG1-4502H
Product Overview : Human GYG partial ORF ( NP_004121, 1 a.a. - 73 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the glycogenin family. Glycogenin is a glycosyltransferase that catalyzes the formation of a short glucose polymer from uridine diphosphate glucose in an autoglucosylation reaction. This reaction is followed by elongation and branching of the polymer, catalyzed by glycogen synthase and branching enzyme, to form glycogen. This gene is expressed in muscle and other tissues. Mutations in this gene result in glycogen storage disease XV. This gene has pseudogenes on chromosomes 1, 8 and 13 respectively. Alternatively spliced transcript variants encoding different isoforms have been identified.[provided by RefSeq, Sep 2010]
Molecular Mass : 33.77 kDa
AA Sequence : MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GYG1 glycogenin 1 [ Homo sapiens ]
Official Symbol GYG1
Synonyms GYG1; glycogenin 1; glycogenin , GYG; glycogenin-1; GN-1; GYG; GSD15;
Gene ID 2992
mRNA Refseq NM_001184720
Protein Refseq NP_001171649
MIM 603942
UniProt ID P46976

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GYG1 Products

Required fields are marked with *

My Review for All GYG1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon