Recombinant Human GYPA protein, His-tagged
Cat.No. : | GYPA-3008H |
Product Overview : | Recombinant Human GYPA protein(A0A0C4DFT7)(20-91aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 20-91aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 12 kDa |
AA Sequence : | LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | GYPA glycophorin A (MNS blood group) [ Homo sapiens ] |
Official Symbol | GYPA |
Synonyms | GYPA; glycophorin A (MNS blood group); glycophorin A (includes MN blood group) , glycophorin A (MN blood group) , MNS; glycophorin-A; CD235a; GPA; MN; glycophorin MiI; glycophorin MiV; glycophorin SAT; glycophorin Erik; glycophorin A, GPA; MN sialoglycoprotein; glycophorin Sta type C; sialoglycoprotein alpha; Mi.V glycoprotein (24 AA); glycophorin A (MN blood group); recombinant glycophorin A-B Miltenberger-DR; erythroid-lineage-specific membrane sialoglycoprotein; MNS; GPSAT; PAS-2; GPErik; HGpMiV; HGpMiXI; HGpSta(C); |
Gene ID | 2993 |
mRNA Refseq | NM_002099 |
Protein Refseq | NP_002090 |
UniProt ID | P02724 |
◆ Recombinant Proteins | ||
RFL23215SF | Recombinant Full Length Pig Glycophorin-A(Gypa) Protein, His-Tagged | +Inquiry |
RFL27503MF | Recombinant Full Length Macaca Fuscata Fuscata Glycophorin-A(Gypa) Protein, His-Tagged | +Inquiry |
GYPA-215HF | Recombinant Full Length Human GYPA Protein | +Inquiry |
GYPA-7405M | Recombinant Mouse GYPA protein, His-tagged | +Inquiry |
Gypa-1824M | Recombinant Mouse Gypa protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GYPA-749HCL | Recombinant Human GYPA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GYPA Products
Required fields are marked with *
My Review for All GYPA Products
Required fields are marked with *
0
Inquiry Basket