Recombinant Human GYPA Protein, His-tagged
Cat.No. : | GYPA-056H |
Product Overview : | Recombinant Human GYPA Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The chromatin immunoprecipitation (ChIP) assay is a powerful and versatile technique used for probing protein-DNA interactions within the natural chromatin context of the cell. This assay can be used to either identify multiple proteins associated with a specific region of the genome or to identify the many regions of the genome bound by a particular protein. ChIP can be used to determine the specific order of recruitment of various proteins to a gene promoter or to "measure" the relative amount of a particular histone modification across an entire gene locus. In addition to histone proteins, the ChIP assay can be used to analyze binding of transcription factors and co-factors, DNA replication factors, and DNA repair proteins. When performing the ChIP assay, cells are first fixed with formaldehyde, a reversible protein-DNA cross-linking agent that "preserves" the protein-DNA interactions occurring in the cell. Cells are lysed and chromatin is harvested and fragmented using either sonication or enzymatic digestion. Fragmented chromatin is then immunoprecipitated with antibodies specific to a particular protein or histone modification. Any DNA sequences that are associated with the protein or histone modification of interest will co-precipitate as part of the cross-linked chromatin complex and the relative amount of that DNA sequence will be enriched by the immunoselection process. After immunoprecipitation, the protein-DNA cross-links are reversed and the DNA is purified. Standard PCR or quantitative real-time PCR are often used to measure the amount of enrichment of a particular DNA sequence by a protein-specific immunoprecipitation. Alternatively, the ChIP assay can be combined with genomic tiling micro-array (ChIP on chip) techniques, high throughput sequencing (ChIP-Seq), or cloning strategies, all of which allow for genome-wide analysis of protein-DNA interactions and histone modifications. SimpleChIP® primers have been optimized for amplification of ChIP-isolated DNA using real-time quantitative PCR and provide important positive and negative controls that can be used to confirm a successful ChIP experiment. |
Molecular Mass : | ~11 kDa |
AA Sequence : | MSSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | GYPA glycophorin A (MNS blood group) [ Homo sapiens (human) ] |
Official Symbol | GYPA |
Synonyms | GYPA; glycophorin A (MNS blood group); glycophorin A (includes MN blood group) , glycophorin A (MN blood group) , MNS; glycophorin-A; CD235a; GPA; MN; glycophorin MiI; glycophorin MiV; glycophorin SAT; glycophorin Erik; glycophorin A, GPA; MN sialoglycoprotein; glycophorin Sta type C; sialoglycoprotein alpha; Mi.V glycoprotein (24 AA); glycophorin A (MN blood group); recombinant glycophorin A-B Miltenberger-DR; erythroid-lineage-specific membrane sialoglycoprotein; MNS; GPSAT; PAS-2; GPErik; HGpMiV; HGpMiXI; HGpSta(C); |
Gene ID | 2993 |
mRNA Refseq | NM_002099 |
Protein Refseq | NP_002090 |
MIM | 617922 |
UniProt ID | P02724 |
◆ Recombinant Proteins | ||
GYPA-4226H | Recombinant Human GYPA Protein (Met1-Glu91), C-His tagged | +Inquiry |
Gypa-3533M | Recombinant Mouse Gypa protein, hFc-tagged | +Inquiry |
RFL27503MF | Recombinant Full Length Macaca Fuscata Fuscata Glycophorin-A(Gypa) Protein, His-Tagged | +Inquiry |
GYPA-3564H | Recombinant Human GYPA protein, hFc-tagged | +Inquiry |
GYPA-1486M | Recombinant Mouse GYPA protein, Fc-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GYPA-749HCL | Recombinant Human GYPA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GYPA Products
Required fields are marked with *
My Review for All GYPA Products
Required fields are marked with *
0
Inquiry Basket