Recombinant Human GZMA Protein

Cat.No. : GZMA-4516H
Product Overview : Human GZMA (P12544) partial recombinant protein expressed in Pichia pastoris.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : P.pastoris
Tag : Non
Description : Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface nonself antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here is a T cell- and natural killer cell-specific serine protease that may function as a common component necessary for lysis of target cells by cytotoxic T lymphocytes and natural killer cells. [provided by RefSeq
Form : Liquid
Molecular Mass : 31 kDa
AA Sequence : EKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLMEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV
Applications : SDS-PAGE
Usage : SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage : Store at -2 centigrade. For long term storage store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : In PBS
Gene Name GZMA granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3) [ Homo sapiens ]
Official Symbol GZMA
Synonyms GZMA; granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3); CTLA3, HFSP; granzyme A; CTL tryptase; Granzyme A (Cytotoxic T lymphocyte associated serine esterase 3; Hanukah factor serine protease); HF; h factor; fragmentin-1; cytotoxic T-lymphocyte proteinase 1; Granzyme A (Cytotoxic T-lymphocyte-associated serine esterase-3; Hanukah factor serine protease); HFSP; CTLA3;
Gene ID 3001
mRNA Refseq NM_006144
Protein Refseq NP_006135
MIM 140050
UniProt ID P12544

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GZMA Products

Required fields are marked with *

My Review for All GZMA Products

Required fields are marked with *

0
cart-icon
0
compare icon