Recombinant Human GZMA Protein
| Cat.No. : | GZMA-4516H |
| Product Overview : | Human GZMA (P12544) partial recombinant protein expressed in Pichia pastoris. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | P.pastoris |
| Tag : | Non |
| Description : | Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface nonself antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here is a T cell- and natural killer cell-specific serine protease that may function as a common component necessary for lysis of target cells by cytotoxic T lymphocytes and natural killer cells. [provided by RefSeq |
| Form : | Liquid |
| Molecular Mass : | 31 kDa |
| AA Sequence : | EKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLMEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV |
| Applications : | SDS-PAGE |
| Usage : | SDS-PAGE The optimal working dilution should be determined by the end user. |
| Storage : | Store at -2 centigrade. For long term storage store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | In PBS |
| Gene Name | GZMA granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3) [ Homo sapiens ] |
| Official Symbol | GZMA |
| Synonyms | GZMA; granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3); CTLA3, HFSP; granzyme A; CTL tryptase; Granzyme A (Cytotoxic T lymphocyte associated serine esterase 3; Hanukah factor serine protease); HF; h factor; fragmentin-1; cytotoxic T-lymphocyte proteinase 1; Granzyme A (Cytotoxic T-lymphocyte-associated serine esterase-3; Hanukah factor serine protease); HFSP; CTLA3; |
| Gene ID | 3001 |
| mRNA Refseq | NM_006144 |
| Protein Refseq | NP_006135 |
| MIM | 140050 |
| UniProt ID | P12544 |
| ◆ Recombinant Proteins | ||
| GZMA-4024M | Recombinant Mouse GZMA Protein, His (Fc)-Avi-tagged | +Inquiry |
| GZMA-427H | ACTIVE Recombinant Human GZMA protein, His-tagged | +Inquiry |
| GZMA-01H | Active Recombinant Human GZMA protein, His-tagged | +Inquiry |
| GZMA-575H | Recombinant Human GZMA protein, His-tagged | +Inquiry |
| GZMA-1036H | Recombinant Human GZMA Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GZMA-5668HCL | Recombinant Human GZMA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GZMA Products
Required fields are marked with *
My Review for All GZMA Products
Required fields are marked with *
