Recombinant Human GZMH Protein, GST-tagged
Cat.No. : | GZMH-4521H |
Product Overview : | Human GZMH full-length ORF ( NP_219491.1, 1 a.a. - 246 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the peptidase S1 family of serine proteases. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate a chymotrypsin-like protease. This protein is reported to be constitutively expressed in the NK (natural killer) cells of the immune system and may play a role in the cytotoxic arm of the innate immune response by inducing target cell death and by directly cleaving substrates in pathogen-infected cells. This gene is present in a gene cluster with another member of the granzyme subfamily on chromosome 14. [provided by RefSeq, Nov 2015] |
Molecular Mass : | 53.7 kDa |
AA Sequence : | MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCGGILVRKDFVLTAAHCQGSSINVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKRL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GZMH granzyme H (cathepsin G-like 2, protein h-CCPX) [ Homo sapiens ] |
Official Symbol | GZMH |
Synonyms | GZMH; granzyme H (cathepsin G-like 2, protein h-CCPX); CTSGL2; granzyme H; CCP X; CGL 2; CSP C; CTLA1; cathepsin G-like 2; cytotoxic serine protease C; cytotoxin serine protease-C; cytotoxic T-lymphocyte proteinase; cytotoxic T-lymphocyte-associated serine esterase 1; CCP-X; CGL-2; CSP-C; |
Gene ID | 2999 |
mRNA Refseq | NM_033423 |
Protein Refseq | NP_219491 |
MIM | 116831 |
UniProt ID | P20718 |
◆ Recombinant Proteins | ||
GZMH-3646H | Recombinant Human GZMH Protein (Glu19-Leu246), N-His tagged | +Inquiry |
GZMH-4521H | Recombinant Human GZMH Protein, GST-tagged | +Inquiry |
GZMH-297H | Recombinant Human GZMH protein, His-tagged | +Inquiry |
GZMH-1856H | Recombinant Human GZMH protein, His & T7-tagged | +Inquiry |
GZMH-3390HF | Recombinant Full Length Human GZMH Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GZMH-2943HCL | Recombinant Human GZMH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GZMH Products
Required fields are marked with *
My Review for All GZMH Products
Required fields are marked with *