Recombinant Human GZMH Protein, GST-tagged
| Cat.No. : | GZMH-4521H |
| Product Overview : | Human GZMH full-length ORF ( NP_219491.1, 1 a.a. - 246 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the peptidase S1 family of serine proteases. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate a chymotrypsin-like protease. This protein is reported to be constitutively expressed in the NK (natural killer) cells of the immune system and may play a role in the cytotoxic arm of the innate immune response by inducing target cell death and by directly cleaving substrates in pathogen-infected cells. This gene is present in a gene cluster with another member of the granzyme subfamily on chromosome 14. [provided by RefSeq, Nov 2015] |
| Molecular Mass : | 53.7 kDa |
| AA Sequence : | MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCGGILVRKDFVLTAAHCQGSSINVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKRL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GZMH granzyme H (cathepsin G-like 2, protein h-CCPX) [ Homo sapiens ] |
| Official Symbol | GZMH |
| Synonyms | GZMH; granzyme H (cathepsin G-like 2, protein h-CCPX); CTSGL2; granzyme H; CCP X; CGL 2; CSP C; CTLA1; cathepsin G-like 2; cytotoxic serine protease C; cytotoxin serine protease-C; cytotoxic T-lymphocyte proteinase; cytotoxic T-lymphocyte-associated serine esterase 1; CCP-X; CGL-2; CSP-C; |
| Gene ID | 2999 |
| mRNA Refseq | NM_033423 |
| Protein Refseq | NP_219491 |
| MIM | 116831 |
| UniProt ID | P20718 |
| ◆ Recombinant Proteins | ||
| GZMH-3390HF | Recombinant Full Length Human GZMH Protein, GST-tagged | +Inquiry |
| GZMH-01HFL | Recombinant Full Length Human GZMH Protein, C-His-tagged | +Inquiry |
| GZMH-1856H | Recombinant Human GZMH protein, His & T7-tagged | +Inquiry |
| GZMH-4521H | Recombinant Human GZMH Protein, GST-tagged | +Inquiry |
| GZMH-3646H | Active Recombinant Human GZMH protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GZMH-2943HCL | Recombinant Human GZMH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GZMH Products
Required fields are marked with *
My Review for All GZMH Products
Required fields are marked with *
