Recombinant Human H2AC12 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : H2AC12-477H
Product Overview : HIST1H2AH MS Standard C13 and N15-labeled recombinant protein (NP_542163) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2A family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the histone microcluster on chromosome 6p21.33.
Molecular Mass : 13.9 kDa
AA Sequence : MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name H2AC12 H2A clustered histone 12 [ Homo sapiens (human) ]
Official Symbol H2AC12
Synonyms HIST1H2AH; histone cluster 1, H2ah; histone 1, H2ah; histone H2A type 1-H; dJ86C11.1; H2A/S; H2AFALii; histone H2A/s; H2A histone family member; MGC171151;
Gene ID 85235
mRNA Refseq NM_080596
Protein Refseq NP_542163
MIM 615013
UniProt ID Q96KK5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All H2AC12 Products

Required fields are marked with *

My Review for All H2AC12 Products

Required fields are marked with *

0
cart-icon