Recombinant Human H2AFX protein
| Cat.No. : | H2AFX-124H |
| Product Overview : | Recombinant human full-length, non-fusion H2AX protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNK KTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. Soluble protein which may be used as substrate for enzymatic assay.2. Active protein, for in vitro histone /DNA reconstitution assay.3. As Immunogen for specific antibody production. |
| Storage : | Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days. |
| Gene Name | H2AFX H2A histone family, member X [ Homo sapiens ] |
| Official Symbol | H2AFX |
| Synonyms | H2AFX; H2A histone family, member X; H2AX; histone H2A.x; H2AX histone; H2A.X; H2A/X; |
| Gene ID | 3014 |
| mRNA Refseq | NM_002105 |
| Protein Refseq | NP_002096 |
| MIM | 601772 |
| UniProt ID | P16104 |
| Chromosome Location | 11q23.3 |
| Pathway | ATM mediated phosphorylation of repair proteins, organism-specific biosystem; ATM mediated response to DNA double-strand break, organism-specific biosystem; Amyloids, organism-specific biosystem; Assembly of the RAD50-MRE11-NBS1 complex at DNA double-strand breaks, organism-specific biosystem; Cell Cycle, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem; DNA Repair, organism-specific biosystem; |
| Function | DNA binding; enzyme binding; histone binding; protein binding; |
| ◆ Recombinant Proteins | ||
| H2AFX-13646H | Recombinant Human H2AFX, GST-tagged | +Inquiry |
| H2AFX-11299Z | Recombinant Zebrafish H2AFX | +Inquiry |
| H2AFX-2027R | Recombinant Rhesus monkey H2AFX Protein, His-tagged | +Inquiry |
| H2AFX-4042M | Recombinant Mouse H2AFX Protein, His (Fc)-Avi-tagged | +Inquiry |
| H2AFX-2059H | Recombinant Human H2A Histone Family, Member X | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| H2AFX-5659HCL | Recombinant Human H2AFX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All H2AFX Products
Required fields are marked with *
My Review for All H2AFX Products
Required fields are marked with *
