Recombinant Human H2AFX protein
Cat.No. : | H2AFX-124H |
Product Overview : | Recombinant human full-length, non-fusion H2AX protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNK KTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY |
Purity : | >90% by SDS-PAGE |
Applications : | 1. Soluble protein which may be used as substrate for enzymatic assay.2. Active protein, for in vitro histone /DNA reconstitution assay.3. As Immunogen for specific antibody production. |
Storage : | Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days. |
Gene Name | H2AFX H2A histone family, member X [ Homo sapiens ] |
Official Symbol | H2AFX |
Synonyms | H2AFX; H2A histone family, member X; H2AX; histone H2A.x; H2AX histone; H2A.X; H2A/X; |
Gene ID | 3014 |
mRNA Refseq | NM_002105 |
Protein Refseq | NP_002096 |
MIM | 601772 |
UniProt ID | P16104 |
Chromosome Location | 11q23.3 |
Pathway | ATM mediated phosphorylation of repair proteins, organism-specific biosystem; ATM mediated response to DNA double-strand break, organism-specific biosystem; Amyloids, organism-specific biosystem; Assembly of the RAD50-MRE11-NBS1 complex at DNA double-strand breaks, organism-specific biosystem; Cell Cycle, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem; DNA Repair, organism-specific biosystem; |
Function | DNA binding; enzyme binding; histone binding; protein binding; |
◆ Recombinant Proteins | ||
H2AFX-4042M | Recombinant Mouse H2AFX Protein, His (Fc)-Avi-tagged | +Inquiry |
H2AFX-1513H | Recombinant Human H2AFX protein, His & GST-tagged | +Inquiry |
H2AFX-1093H | Recombinant Human H2AFX protein, His-GST-tagged | +Inquiry |
H2AFX-7429M | Recombinant Mouse H2AFX Protein | +Inquiry |
H2AFX-13646H | Recombinant Human H2AFX, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
H2AFX-5659HCL | Recombinant Human H2AFX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All H2AFX Products
Required fields are marked with *
My Review for All H2AFX Products
Required fields are marked with *