Recombinant Human H2AFY protein, T7/His-tagged
Cat.No. : | H2AFY-117H |
Product Overview : | Recombinant human H2AFY gene (derived from BC095406) fused with T7/His/TEV cleavage site 29aa Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPV YMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRGSKG KLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKSKKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLGQKL NLIHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKF VIHCNSPVWGADKCEELLEKTVKNCLALADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIK TVYFVLFDSESIGIYVQEMAKLDAN |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used as specific substrate protein for kinase enzymatic assay.2. May be used for in vitro histone/DNA reconstitution assay.3. May be used as native immunogen for specific antibody production.4. May be used as protein biomarker for Huntinton disease monitoring. |
Storage : | Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days. |
Gene Name | H2AFY H2A histone family, member Y [ Homo sapiens ] |
Official Symbol | H2AFY |
Synonyms | H2AFY; H2A histone family, member Y; core histone macro-H2A.1; macroH2A1.2; histone H2A.y |
Gene ID | 9555 |
mRNA Refseq | NM_001040158 |
Protein Refseq | NP_001035248 |
MIM | 610054 |
UniProt ID | O75367 |
Chromosome Location | 5q31.1 |
Pathway | ATF-2 transcription factor network, organism-specific biosystem; Systemic lupus erythematosus, organism-specific biosystem; Systemic lupus erythematosus, conserved biosystem; |
Function | DNA binding; chromatin binding; |
◆ Recombinant Proteins | ||
H2AFY-3404HF | Recombinant Full Length Human H2AFY Protein, GST-tagged | +Inquiry |
H2AFY-2430R | Recombinant Rat H2AFY Protein, His (Fc)-Avi-tagged | +Inquiry |
H2AFY-1705H | Recombinant Human H2AFY protein, His & GST-tagged | +Inquiry |
H2AFY-117H | Recombinant Human H2AFY protein, T7/His-tagged | +Inquiry |
H2AFY-2028R | Recombinant Rhesus monkey H2AFY Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
H2AFY-5658HCL | Recombinant Human H2AFY 293 Cell Lysate | +Inquiry |
H2AFY-5657HCL | Recombinant Human H2AFY 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All H2AFY Products
Required fields are marked with *
My Review for All H2AFY Products
Required fields are marked with *
0
Inquiry Basket